BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0712.Seq (704 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC902.06 |mto2||MT organizer Mto2|Schizosaccharomyces pombe|ch... 28 1.1 SPBC660.16 |||phosphogluconate dehydrogenase, decarboxylating |S... 27 2.6 SPAC31A2.11c |cuf1||Cu metalloregulatory transcription factor Cu... 25 8.0 >SPBC902.06 |mto2||MT organizer Mto2|Schizosaccharomyces pombe|chr 2|||Manual Length = 397 Score = 28.3 bits (60), Expect = 1.1 Identities = 15/47 (31%), Positives = 26/47 (55%) Frame = +2 Query: 296 LENDEDPHSNIKTSFDSNFSNGHSKFATQATTRVPSEQVVCVLSYLK 436 L+++E H N++T+ S+ S HSK T +T P Q+ S+ + Sbjct: 301 LQSNELSHHNVRTTLFSDDSRFHSKIHTHST---PPSQMYSAASHFR 344 >SPBC660.16 |||phosphogluconate dehydrogenase, decarboxylating |Schizosaccharomyces pombe|chr 2|||Manual Length = 492 Score = 27.1 bits (57), Expect = 2.6 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -3 Query: 546 PVIIPGGDPAAGPWIQTRFRVL 481 P ++PGG+PAA P I+ F+ L Sbjct: 142 PSLMPGGNPAAWPRIKPIFQTL 163 >SPAC31A2.11c |cuf1||Cu metalloregulatory transcription factor Cuf1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 411 Score = 25.4 bits (53), Expect = 8.0 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 3/33 (9%) Frame = -2 Query: 448 GHRSLEIR*NTHDLFARHPRGR---LCRKLRMS 359 GHRS + N +LF P+GR C K R++ Sbjct: 17 GHRSSTCKHNDRELFPIRPKGRPISQCEKCRIA 49 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,544,872 Number of Sequences: 5004 Number of extensions: 45464 Number of successful extensions: 121 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 121 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 327172622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -