BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0711.Seq (839 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0365 - 16818468-16818514,16818619-16821706,16822860-168229... 29 6.1 04_01_0599 + 7871933-7872004,7872696-7873168,7873257-7873334,787... 29 6.1 >11_04_0365 - 16818468-16818514,16818619-16821706,16822860-16822919, 16823595-16823954 Length = 1184 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/51 (31%), Positives = 29/51 (56%) Frame = +2 Query: 311 MNKLIRELELFKFEFTEIRLCIYLPSFIFQPFFCPRFLRYRERFYAVMRQP 463 MNK + L+ + +F+E+ C+++P + F P+ +RY Y M+QP Sbjct: 706 MNK--KHLQFLQLDFSEVE-CLHMPLQLGLNF-TPKEVRYENLQYQYMQQP 752 >04_01_0599 + 7871933-7872004,7872696-7873168,7873257-7873334, 7873446-7873665 Length = 280 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -1 Query: 755 PRRLSWVTPGFSPVTTFVNDGQWNCNTTHYRA 660 P R++ V PG S +DG+W T HY+A Sbjct: 91 PERIATV-PGSSAAAFKHDDGKWKLRTKHYKA 121 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,569,202 Number of Sequences: 37544 Number of extensions: 347121 Number of successful extensions: 617 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 606 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 617 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2326952232 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -