BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0711.Seq (839 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 44 2e-04 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 44 2e-04 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 44 2e-04 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 44 2e-04 SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 41 0.001 SB_57792| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_16590| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_25782| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_20754| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_37627| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_18654| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_33777| Best HMM Match : BTP (HMM E-Value=8.9) 38 0.010 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_49046| Best HMM Match : BA14K (HMM E-Value=6.4) 38 0.013 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 37 0.018 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 37 0.018 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 37 0.018 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 37 0.018 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 37 0.018 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 37 0.018 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 37 0.018 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 37 0.018 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 37 0.018 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 37 0.018 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 37 0.018 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 37 0.018 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 37 0.018 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 37 0.018 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 37 0.018 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 37 0.018 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 37 0.018 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 37 0.018 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 37 0.018 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 37 0.018 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 37 0.018 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 37 0.018 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 37 0.018 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 37 0.018 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 37 0.018 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 37 0.018 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 37 0.018 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 37 0.018 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 37 0.018 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 37 0.018 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 37 0.018 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 37 0.018 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 37 0.018 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 37 0.018 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 37 0.018 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 37 0.018 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 37 0.018 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 37 0.018 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 37 0.018 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 37 0.018 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 37 0.018 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 37 0.018 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 37 0.018 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 37 0.018 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 37 0.018 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 37 0.018 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 37 0.018 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 37 0.018 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) 37 0.018 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 37 0.018 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 37 0.018 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 37 0.018 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 37 0.018 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 37 0.018 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 37 0.018 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 37 0.018 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 37 0.018 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 37 0.018 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 37 0.018 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 37 0.018 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 37 0.018 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 37 0.018 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 37 0.018 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 37 0.018 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 37 0.018 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_29000| Best HMM Match : DUF551 (HMM E-Value=2.2) 37 0.018 SB_28961| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 37 0.018 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 37 0.018 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 37 0.018 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 37 0.018 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_26380| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_26309| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_25848| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_25610| Best HMM Match : MAT_Alpha1 (HMM E-Value=7.2) 37 0.018 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 59.7 bits (138), Expect = 3e-09 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +1 Query: 679 LQFHWPSFTNVVTGENPGVTQLNRLGSXPPFSXSW 783 + HWPSF NVVTG+NPGVTQLNRL + PPF+ SW Sbjct: 4 ITIHWPSFYNVVTGKNPGVTQLNRLAAHPPFA-SW 37 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 56.4 bits (130), Expect = 3e-08 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = +1 Query: 679 LQFHWPSFTNVVTGENPGVTQLNRLGSXPPFSXSW 783 + HWPSF NVVTG+N GVTQLNRL + PPF+ SW Sbjct: 4 ITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFA-SW 37 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 56.4 bits (130), Expect = 3e-08 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = +1 Query: 679 LQFHWPSFTNVVTGENPGVTQLNRLGSXPPFSXSW 783 + HWPSF NVVTG+N GVTQLNRL + PPF+ SW Sbjct: 4 ITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFA-SW 37 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 56.0 bits (129), Expect = 4e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -1 Query: 770 KGGXLPRRLSWVTPGFSPVTTFVNDGQWNCNTTHYRANW 654 KGG RRLSWVTPGF P V NCNTTHYRANW Sbjct: 43 KGGCAARRLSWVTPGF-PSHDVVKRRPVNCNTTHYRANW 80 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 55.2 bits (127), Expect = 6e-08 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = +1 Query: 679 LQFHWPSFTNVVTGENPGVTQLNRLGSXPPFSXSW 783 + HWPSF NVV ENPGVTQLNRL + PPF+ SW Sbjct: 4 ITIHWPSFYNVVHWENPGVTQLNRLAAHPPFA-SW 37 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = +1 Query: 685 FHWPSFTNVVTGENPGVTQLNRLGSXPPFSXSW 783 +HWPSF NVVTG+ GVTQLNRL + PPF+ SW Sbjct: 4 WHWPSFYNVVTGKTLGVTQLNRLAAHPPFA-SW 35 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 51.2 bits (117), Expect = 1e-06 Identities = 21/35 (60%), Positives = 26/35 (74%) Frame = +1 Query: 679 LQFHWPSFTNVVTGENPGVTQLNRLGSXPPFSXSW 783 + HWPSF NV+ + PGVTQLNRL + PPF+ SW Sbjct: 4 ITIHWPSFYNVMLAKTPGVTQLNRLAAHPPFA-SW 37 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 50.8 bits (116), Expect = 1e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = +1 Query: 679 LQFHWPSFTNVVTGENPGVTQLNRLGSXPPFSXSW 783 + HWPSF NVVTG+ VTQLNRL + PPF+ SW Sbjct: 4 ITIHWPSFYNVVTGKTLSVTQLNRLAAHPPFA-SW 37 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 47.2 bits (107), Expect = 2e-05 Identities = 25/55 (45%), Positives = 32/55 (58%), Gaps = 2/55 (3%) Frame = +1 Query: 625 TSPLHRGPGTQFAL**VV--LQFHWPSFTNVVTGENPGVTQLNRLGSXPPFSXSW 783 TS + G + A+ +V + HWPSF ENPGV QLNRL + PPF+ SW Sbjct: 5 TSSIAAGIAVELAIRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPFA-SW 58 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 45.2 bits (102), Expect = 7e-05 Identities = 20/35 (57%), Positives = 23/35 (65%) Frame = +1 Query: 679 LQFHWPSFTNVVTGENPGVTQLNRLGSXPPFSXSW 783 + HWPS ENPGVTQLNRL + PPF+ SW Sbjct: 280 ITIHWPSVLQRRDWENPGVTQLNRLAAHPPFA-SW 313 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 43.6 bits (98), Expect = 2e-04 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = -1 Query: 770 KGGXLPRRLSWVTPGFSPVTTFVNDGQWNCNTTHYRANW 654 KGG RRLSW GF P V NCNTTHYRANW Sbjct: 614 KGGCAARRLSW---GF-PSHDVVKRRPVNCNTTHYRANW 648 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/35 (51%), Positives = 23/35 (65%) Frame = +1 Query: 679 LQFHWPSFTNVVTGENPGVTQLNRLGSXPPFSXSW 783 + HWP+F N TG+ TQLNRL + PPF+ SW Sbjct: 47 ITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFA-SW 80 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 43.6 bits (98), Expect = 2e-04 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = -1 Query: 770 KGGXLPRRLSWVTPGFSPVTTFVNDGQWNCNTTHYRANW 654 KGG RRLSW GF P V NCNTTHYRANW Sbjct: 57 KGGCAARRLSW---GF-PSHDVVKRRPVNCNTTHYRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 43.6 bits (98), Expect = 2e-04 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = -1 Query: 770 KGGXLPRRLSWVTPGFSPVTTFVNDGQWNCNTTHYRANW 654 KGG RRLSW GF P V NCNTTHYRANW Sbjct: 57 KGGCAARRLSW---GF-PSHDVVKRRPVNCNTTHYRANW 91 >SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/26 (73%), Positives = 22/26 (84%) Frame = +1 Query: 706 NVVTGENPGVTQLNRLGSXPPFSXSW 783 NVVTG+ PGVTQLNRL + PPF+ SW Sbjct: 13 NVVTGKTPGVTQLNRLAAHPPFA-SW 37 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 41.5 bits (93), Expect = 8e-04 Identities = 23/40 (57%), Positives = 24/40 (60%) Frame = -1 Query: 839 CATVGEGRIGCGPLPLIXGQLXEKGGXLPRRLSWVTPGFS 720 CATVG+G CGPL KG L RLSWVTPGFS Sbjct: 2 CATVGKGD-RCGPLRYYAS--WRKGDVLQGRLSWVTPGFS 38 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/39 (58%), Positives = 26/39 (66%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSWPXISGRGPHPIRPSPTVA 837 ENPGVTQLNRL + PPF+ SW + PH P PTVA Sbjct: 354 ENPGVTQLNRLAAHPPFA-SWR--NSERPHR-SPFPTVA 388 >SB_57792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/40 (52%), Positives = 27/40 (67%) Frame = +1 Query: 706 NVVTGENPGVTQLNRLGSXPPFSXSWPXISGRGPHPIRPS 825 N VTG+ PGVTQLNRL + PPF+ +W + + H RPS Sbjct: 8 NDVTGKTPGVTQLNRLAAHPPFA-NWR--NSKEDHSDRPS 44 >SB_16590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = +1 Query: 718 GENPGVTQLNRLGSXPPFSXSW 783 GENPGVTQLNRL + PPF+ SW Sbjct: 38 GENPGVTQLNRLAAHPPFA-SW 58 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/35 (48%), Positives = 22/35 (62%) Frame = +1 Query: 679 LQFHWPSFTNVVTGENPGVTQLNRLGSXPPFSXSW 783 + HWPSF NVVTG+ + L L + PPF+ SW Sbjct: 4 ITIHWPSFYNVVTGKTLALPNLIALAAHPPFA-SW 37 >SB_25782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRLG PPF+ SW Sbjct: 18 ENPGVTQLNRLGGHPPFA-SW 37 >SB_20754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSWPXISGRGPHP 813 ENPGVTQLNRLG+ PPF+ GR P Sbjct: 18 ENPGVTQLNRLGAHPPFARWLNSEEGRTDRP 48 >SB_37627| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 38.7 bits (86), Expect = 0.006 Identities = 35/101 (34%), Positives = 48/101 (47%), Gaps = 3/101 (2%) Frame = +1 Query: 490 RDSRPVESTLLSFHYQEKEQGVFFSNAYILD*APTATISQSRTTQTSPLHRGPGTQFAL* 669 RDSR E+ LL +E E G S+ D + + +T + QFAL Sbjct: 72 RDSR--ENGLLRGELEEVETGDGVSSQLSSDKSNIEFLQPGGSTSSRAAATAVELQFAL- 128 Query: 670 *VVLQFHWPSFTNVVTG---ENPGVTQLNRLGSXPPFSXSW 783 + ++ S V+ ENPGVTQLNRL + PPF+ SW Sbjct: 129 ---YESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFA-SW 165 >SB_18654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 392 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSWPXISGRGPHP 813 ENPGVTQLNRL + PPF+ SW + R P Sbjct: 311 ENPGVTQLNRLAAHPPFA-SWRSLVSRVRKP 340 >SB_33777| Best HMM Match : BTP (HMM E-Value=8.9) Length = 156 Score = 37.9 bits (84), Expect = 0.010 Identities = 30/94 (31%), Positives = 44/94 (46%), Gaps = 4/94 (4%) Frame = +1 Query: 514 TLLSFHYQEKEQGVFFSNA-YILD*APTATISQSRTTQTSPLHRGPGTQFAL**VVLQFH 690 TL+S + G+ F Y+ +P + +T + QFAL + + Sbjct: 7 TLISANIPRVYHGLLFHGILYLFTLSPIEFLQPGGSTSSRAAATAVELQFAL----YESY 62 Query: 691 WPSFTNVVTG---ENPGVTQLNRLGSXPPFSXSW 783 + S V+ ENPGVTQLNRL + PPF+ SW Sbjct: 63 YNSLAVVLQRRDWENPGVTQLNRLAAHPPFA-SW 95 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/35 (48%), Positives = 21/35 (60%) Frame = +1 Query: 679 LQFHWPSFTNVVTGENPGVTQLNRLGSXPPFSXSW 783 + HWPSF NVVTG+ + L L PPF+ SW Sbjct: 4 ITIHWPSFYNVVTGKTLALPNLIALQHIPPFA-SW 37 >SB_49046| Best HMM Match : BA14K (HMM E-Value=6.4) Length = 120 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSWPXI 792 ENPGVTQLNRL + PPF+ SW I Sbjct: 39 ENPGVTQLNRLAAHPPFA-SWRNI 61 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 45 ENPGVTQLNRLAAHPPFA-SW 64 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 25 ENPGVTQLNRLAAHPPFA-SW 44 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 72 ENPGVTQLNRLAAHPPFA-SW 91 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 54 ENPGVTQLNRLAAHPPFA-SW 73 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 46 ENPGVTQLNRLAAHPPFA-SW 65 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 72 ENPGVTQLNRLAAHPPFA-SW 91 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 77 ENPGVTQLNRLAAHPPFA-SW 96 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 48 ENPGVTQLNRLAAHPPFA-SW 67 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 68 ENPGVTQLNRLAAHPPFA-SW 87 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 80 ENPGVTQLNRLAAHPPFA-SW 99 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 56 ENPGVTQLNRLAAHPPFA-SW 75 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 45 ENPGVTQLNRLAAHPPFA-SW 64 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 35 ENPGVTQLNRLAAHPPFA-SW 54 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 60 ENPGVTQLNRLAAHPPFA-SW 79 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 69 ENPGVTQLNRLAAHPPFA-SW 88 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 63 ENPGVTQLNRLAAHPPFA-SW 82 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 79 ENPGVTQLNRLAAHPPFA-SW 98 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 67 ENPGVTQLNRLAAHPPFA-SW 86 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 50 ENPGVTQLNRLAAHPPFA-SW 69 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 50 ENPGVTQLNRLAAHPPFA-SW 69 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 226 ENPGVTQLNRLAAHPPFA-SW 245 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 121 ENPGVTQLNRLAAHPPFA-SW 140 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 59 ENPGVTQLNRLAAHPPFA-SW 78 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 38 ENPGVTQLNRLAAHPPFA-SW 57 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 26 ENPGVTQLNRLAAHPPFA-SW 45 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 57 ENPGVTQLNRLAAHPPFA-SW 76 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 391 ENPGVTQLNRLAAHPPFA-SW 410 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 117 ENPGVTQLNRLAAHPPFA-SW 136 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 93 ENPGVTQLNRLAAHPPFA-SW 112 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 49 ENPGVTQLNRLAAHPPFA-SW 68 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 18 ENPGVTQLNRLAAHPPFA-SW 37 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 28 ENPGVTQLNRLAAHPPFA-SW 47 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 48 ENPGVTQLNRLAAHPPFA-SW 67 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 113 ENPGVTQLNRLAAHPPFA-SW 132 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 55 ENPGVTQLNRLAAHPPFA-SW 74 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 350 ENPGVTQLNRLAAHPPFA-SW 369 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 90 ENPGVTQLNRLAAHPPFA-SW 109 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 60 ENPGVTQLNRLAAHPPFA-SW 79 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 26 ENPGVTQLNRLAAHPPFA-SW 45 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 69 ENPGVTQLNRLAAHPPFA-SW 88 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 53 ENPGVTQLNRLAAHPPFA-SW 72 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 144 ENPGVTQLNRLAAHPPFA-SW 163 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 73 ENPGVTQLNRLAAHPPFA-SW 92 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 49 ENPGVTQLNRLAAHPPFA-SW 68 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 153 ENPGVTQLNRLAAHPPFA-SW 172 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 843 ENPGVTQLNRLAAHPPFA-SW 862 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 26 ENPGVTQLNRLAAHPPFA-SW 45 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 70 ENPGVTQLNRLAAHPPFA-SW 89 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 44 ENPGVTQLNRLAAHPPFA-SW 63 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 83 ENPGVTQLNRLAAHPPFA-SW 102 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 77 ENPGVTQLNRLAAHPPFA-SW 96 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 66 ENPGVTQLNRLAAHPPFA-SW 85 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 79 ENPGVTQLNRLAAHPPFA-SW 98 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 75 ENPGVTQLNRLAAHPPFA-SW 94 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 266 ENPGVTQLNRLAAHPPFA-SW 285 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 124 ENPGVTQLNRLAAHPPFA-SW 143 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 60 ENPGVTQLNRLAAHPPFA-SW 79 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 46 ENPGVTQLNRLAAHPPFA-SW 65 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 47 ENPGVTQLNRLAAHPPFA-SW 66 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 111 ENPGVTQLNRLAAHPPFA-SW 130 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 124 ENPGVTQLNRLAAHPPFA-SW 143 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 49 ENPGVTQLNRLAAHPPFA-SW 68 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 30 ENPGVTQLNRLAAHPPFA-SW 49 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 68 ENPGVTQLNRLAAHPPFA-SW 87 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 47 ENPGVTQLNRLAAHPPFA-SW 66 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 44 ENPGVTQLNRLAAHPPFA-SW 63 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 21 ENPGVTQLNRLAAHPPFA-SW 40 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 29 ENPGVTQLNRLAAHPPFA-SW 48 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 406 ENPGVTQLNRLAAHPPFA-SW 425 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 55 ENPGVTQLNRLAAHPPFA-SW 74 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 64 ENPGVTQLNRLAAHPPFA-SW 83 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 46 ENPGVTQLNRLAAHPPFA-SW 65 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 129 ENPGVTQLNRLAAHPPFA-SW 148 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 65 ENPGVTQLNRLAAHPPFA-SW 84 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 75 ENPGVTQLNRLAAHPPFA-SW 94 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 78 ENPGVTQLNRLAAHPPFA-SW 97 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 424 ENPGVTQLNRLAAHPPFA-SW 443 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 121 ENPGVTQLNRLAAHPPFA-SW 140 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 77 ENPGVTQLNRLAAHPPFA-SW 96 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 66 ENPGVTQLNRLAAHPPFA-SW 85 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 56 ENPGVTQLNRLAAHPPFA-SW 75 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 59 ENPGVTQLNRLAAHPPFA-SW 78 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 171 ENPGVTQLNRLAAHPPFA-SW 190 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 75 ENPGVTQLNRLAAHPPFA-SW 94 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 62 ENPGVTQLNRLAAHPPFA-SW 81 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 98 ENPGVTQLNRLAAHPPFA-SW 117 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 47 ENPGVTQLNRLAAHPPFA-SW 66 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 73 ENPGVTQLNRLAAHPPFA-SW 92 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 52 ENPGVTQLNRLAAHPPFA-SW 71 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 195 ENPGVTQLNRLAAHPPFA-SW 214 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 44 ENPGVTQLNRLAAHPPFA-SW 63 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 50 ENPGVTQLNRLAAHPPFA-SW 69 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 64 ENPGVTQLNRLAAHPPFA-SW 83 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 61 ENPGVTQLNRLAAHPPFA-SW 80 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 44 ENPGVTQLNRLAAHPPFA-SW 63 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 45 ENPGVTQLNRLAAHPPFA-SW 64 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 59 ENPGVTQLNRLAAHPPFA-SW 78 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 49 ENPGVTQLNRLAAHPPFA-SW 68 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 142 ENPGVTQLNRLAAHPPFA-SW 161 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 51 ENPGVTQLNRLAAHPPFA-SW 70 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 94 ENPGVTQLNRLAAHPPFA-SW 113 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 32 ENPGVTQLNRLAAHPPFA-SW 51 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 163 ENPGVTQLNRLAAHPPFA-SW 182 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 350 ENPGVTQLNRLAAHPPFA-SW 369 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 67 ENPGVTQLNRLAAHPPFA-SW 86 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +3 Query: 630 TTTPGARYPIRPIVSRITIPLAVVYKRRDWGKP 728 TT P P+ ++ LAVV +RRDW P Sbjct: 37 TTIPWYGDPLESTCRHASLALAVVLQRRDWENP 69 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 31 ENPGVTQLNRLAAHPPFA-SW 50 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 57 ENPGVTQLNRLAAHPPFA-SW 76 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 119 ENPGVTQLNRLAAHPPFA-SW 138 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 96 ENPGVTQLNRLAAHPPFA-SW 115 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 46 ENPGVTQLNRLAAHPPFA-SW 65 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 70 ENPGVTQLNRLAAHPPFA-SW 89 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 304 ENPGVTQLNRLAAHPPFA-SW 323 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 67 ENPGVTQLNRLAAHPPFA-SW 86 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 68 ENPGVTQLNRLAAHPPFA-SW 87 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 26 ENPGVTQLNRLAAHPPFA-SW 45 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 46 ENPGVTQLNRLAAHPPFA-SW 65 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 421 ENPGVTQLNRLAAHPPFA-SW 440 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 105 ENPGVTQLNRLAAHPPFA-SW 124 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 61 ENPGVTQLNRLAAHPPFA-SW 80 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 53 ENPGVTQLNRLAAHPPFA-SW 72 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 103 ENPGVTQLNRLAAHPPFA-SW 122 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 53 ENPGVTQLNRLAAHPPFA-SW 72 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 221 ENPGVTQLNRLAAHPPFA-SW 240 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 53 ENPGVTQLNRLAAHPPFA-SW 72 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 223 ENPGVTQLNRLAAHPPFA-SW 242 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 43 ENPGVTQLNRLAAHPPFA-SW 62 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 58 ENPGVTQLNRLAAHPPFA-SW 77 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 48 ENPGVTQLNRLAAHPPFA-SW 67 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 53 ENPGVTQLNRLAAHPPFA-SW 72 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 157 ENPGVTQLNRLAAHPPFA-SW 176 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 55 ENPGVTQLNRLAAHPPFA-SW 74 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 45 ENPGVTQLNRLAAHPPFA-SW 64 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 65 ENPGVTQLNRLAAHPPFA-SW 84 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 50 ENPGVTQLNRLAAHPPFA-SW 69 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 85 ENPGVTQLNRLAAHPPFA-SW 104 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 205 ENPGVTQLNRLAAHPPFA-SW 224 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 63 ENPGVTQLNRLAAHPPFA-SW 82 >SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 42 ENPGVTQLNRLAAHPPFA-SW 61 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 96 ENPGVTQLNRLAAHPPFA-SW 115 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 32 ENPGVTQLNRLAAHPPFA-SW 51 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 59 ENPGVTQLNRLAAHPPFA-SW 78 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 197 ENPGVTQLNRLAAHPPFA-SW 216 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 67 ENPGVTQLNRLAAHPPFA-SW 86 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 77 ENPGVTQLNRLAAHPPFA-SW 96 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 60 ENPGVTQLNRLAAHPPFA-SW 79 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 67 ENPGVTQLNRLAAHPPFA-SW 86 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 110 ENPGVTQLNRLAAHPPFA-SW 129 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 86 ENPGVTQLNRLAAHPPFA-SW 105 >SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 106 ENPGVTQLNRLAAHPPFA-SW 125 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 83 ENPGVTQLNRLAAHPPFA-SW 102 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 50 ENPGVTQLNRLAAHPPFA-SW 69 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 59 ENPGVTQLNRLAAHPPFA-SW 78 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 673 ENPGVTQLNRLAAHPPFA-SW 692 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 58 ENPGVTQLNRLAAHPPFA-SW 77 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 47 ENPGVTQLNRLAAHPPFA-SW 66 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 38 ENPGVTQLNRLAAHPPFA-SW 57 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 156 ENPGVTQLNRLAAHPPFA-SW 175 >SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 48 ENPGVTQLNRLAAHPPFA-SW 67 >SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 69 ENPGVTQLNRLAAHPPFA-SW 88 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 98 ENPGVTQLNRLAAHPPFA-SW 117 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 46 ENPGVTQLNRLAAHPPFA-SW 65 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 110 ENPGVTQLNRLAAHPPFA-SW 129 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 53 ENPGVTQLNRLAAHPPFA-SW 72 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 1200 ENPGVTQLNRLAAHPPFA-SW 1219 >SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 52 ENPGVTQLNRLAAHPPFA-SW 71 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 42 ENPGVTQLNRLAAHPPFA-SW 61 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 135 ENPGVTQLNRLAAHPPFA-SW 154 >SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 66 ENPGVTQLNRLAAHPPFA-SW 85 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 87 ENPGVTQLNRLAAHPPFA-SW 106 >SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 60 ENPGVTQLNRLAAHPPFA-SW 79 >SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 136 ENPGVTQLNRLAAHPPFA-SW 155 >SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 178 ENPGVTQLNRLAAHPPFA-SW 197 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 41 ENPGVTQLNRLAAHPPFA-SW 60 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 90 ENPGVTQLNRLAAHPPFA-SW 109 >SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 40 ENPGVTQLNRLAAHPPFA-SW 59 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 55 ENPGVTQLNRLAAHPPFA-SW 74 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 26 ENPGVTQLNRLAAHPPFA-SW 45 >SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) Length = 496 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 85 ENPGVTQLNRLAAHPPFA-SW 104 >SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 935 ENPGVTQLNRLAAHPPFA-SW 954 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 44 ENPGVTQLNRLAAHPPFA-SW 63 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 46 ENPGVTQLNRLAAHPPFA-SW 65 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 56 ENPGVTQLNRLAAHPPFA-SW 75 >SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 46 ENPGVTQLNRLAAHPPFA-SW 65 >SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 106 ENPGVTQLNRLAAHPPFA-SW 125 >SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) Length = 718 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 363 ENPGVTQLNRLAAHPPFA-SW 382 >SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 93 ENPGVTQLNRLAAHPPFA-SW 112 >SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 721 ENPGVTQLNRLGSXPPFSXSW 783 ENPGVTQLNRL + PPF+ SW Sbjct: 39 ENPGVTQLNRLAAHPPFA-SW 58 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,838,106 Number of Sequences: 59808 Number of extensions: 411915 Number of successful extensions: 6522 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3652 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6507 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2371447782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -