BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0707.Seq (741 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT010056-1|AAQ22525.1| 1417|Drosophila melanogaster LD18032p pro... 30 3.8 AE014134-3263|AAF53910.3| 1621|Drosophila melanogaster CG31678-P... 30 3.8 >BT010056-1|AAQ22525.1| 1417|Drosophila melanogaster LD18032p protein. Length = 1417 Score = 29.9 bits (64), Expect = 3.8 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -3 Query: 229 KAY-QTPGKATPKGSSMSEKLQKVLARAGHGSRREIESIIEAGRVSV 92 K+Y QTP ++TPK SE+ +L G + +E++ ++SV Sbjct: 1056 KSYEQTPNQSTPKQRRPSEEAMLILKECGDSNMQELDPPSRQRKISV 1102 >AE014134-3263|AAF53910.3| 1621|Drosophila melanogaster CG31678-PA protein. Length = 1621 Score = 29.9 bits (64), Expect = 3.8 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -3 Query: 229 KAY-QTPGKATPKGSSMSEKLQKVLARAGHGSRREIESIIEAGRVSV 92 K+Y QTP ++TPK SE+ +L G + +E++ ++SV Sbjct: 1260 KSYEQTPNQSTPKQRRPSEEAMLILKECGDSNMQELDPPSRQRKISV 1306 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,241,152 Number of Sequences: 53049 Number of extensions: 504117 Number of successful extensions: 991 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 967 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 991 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3355404063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -