BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0706.Seq (894 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2F12.02c |mrpl7||mitochondrial ribosomal protein subunit L7|... 28 1.6 SPAC16C9.07 |ppk5|SPAC2G11.01, mug189|serine/threonine protein k... 27 4.8 SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr... 27 4.8 SPBC1709.01 |chs2|SPBC1734.17|chitin synthase homolog Chs2|Schiz... 26 8.3 >SPBC2F12.02c |mrpl7||mitochondrial ribosomal protein subunit L7|Schizosaccharomyces pombe|chr 2|||Manual Length = 287 Score = 28.3 bits (60), Expect = 1.6 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Frame = +1 Query: 676 NVDFQTSXGEKPVYQGDGPTYVNHHPNQVFGVK--VPXST*IRNPKGSPPIXKL 831 + D T P + GD P Y N P ++ G K +P + NPK P I K+ Sbjct: 78 STDEHTQKDRLPRWIGDNPYYKNRPPQKMRGNKPLLPVKESV-NPKNLPSISKV 130 >SPAC16C9.07 |ppk5|SPAC2G11.01, mug189|serine/threonine protein kinase Ppk5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 836 Score = 26.6 bits (56), Expect = 4.8 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 691 FGSPRSLIVDSCSKLEQHSTLSRSILLI 608 F SP +L +CS L HST + L+ Sbjct: 26 FLSPNNLTEQTCSPLRAHSTFKEPVFLL 53 >SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1275 Score = 26.6 bits (56), Expect = 4.8 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 5/63 (7%) Frame = +3 Query: 318 PIRPIVSRITIHWPSFYNVVTGKTLALPNLIALQ-----HIPLSPAGVIAKRPAPIALPN 482 P P+ S ++ H + + +L N I+L ++PLSP A+ P+PI L + Sbjct: 172 PRPPLPSSVSSHSSPYSTTSSTSLYSLYNDISLSCSPEPYLPLSPTRSPARTPSPIRLYS 231 Query: 483 SCA 491 S A Sbjct: 232 SDA 234 >SPBC1709.01 |chs2|SPBC1734.17|chitin synthase homolog Chs2|Schizosaccharomyces pombe|chr 2|||Manual Length = 926 Score = 25.8 bits (54), Expect = 8.3 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -2 Query: 500 PFXCATVGKGDRCGPLRYYASWRKGDV 420 P C V G R GP Y +W+ DV Sbjct: 392 PKVCLFVRNGARLGPTSIYHAWKAFDV 418 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,108,374 Number of Sequences: 5004 Number of extensions: 57992 Number of successful extensions: 115 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 115 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 450492750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -