BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0706.Seq (894 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 23 9.5 AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 23 9.5 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 9.5 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -1 Query: 225 QQRLPRRRGASRAGDQDVARLADQLVGRRRRK 130 QQR P+R+ + + Q R+ Q +R+RK Sbjct: 308 QQRQPQRQAVAGSQQQQQERMQQQQQLQRKRK 339 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 23.4 bits (48), Expect = 9.5 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -1 Query: 216 LPRRRGASRAGDQDVARLADQLVGR 142 +P + + R D VAR A++LVG+ Sbjct: 574 IPLNKISGRKIDPSVARFAEELVGK 598 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.4 bits (48), Expect = 9.5 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 386 NPGVTQLNRLAAHPPFASWRNS 451 +PG +L+ HPP AS R+S Sbjct: 835 HPGAQTQPQLSQHPPGASGRSS 856 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 793,069 Number of Sequences: 2352 Number of extensions: 15767 Number of successful extensions: 26 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 96334083 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -