BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0704.Seq (919 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC13G6.10c |||O-glucosyl hydrolase |Schizosaccharomyces pombe|... 28 1.6 SPBC1778.10c |ppk21|SPBC4C3.11|serine/threonine protein kinase P... 27 3.7 SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr... 27 4.9 >SPAC13G6.10c |||O-glucosyl hydrolase |Schizosaccharomyces pombe|chr 1|||Manual Length = 530 Score = 28.3 bits (60), Expect = 1.6 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 716 TVFPPFDVGSPTFFNSGLLXPNWNNTSXPIS 624 T +P V +P + + P W+NTS P+S Sbjct: 104 TSYPATFVSTPLYTMDNVTAPVWSNTSVPVS 134 >SPBC1778.10c |ppk21|SPBC4C3.11|serine/threonine protein kinase Ppk21|Schizosaccharomyces pombe|chr 2|||Manual Length = 550 Score = 27.1 bits (57), Expect = 3.7 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = +2 Query: 5 VPNSAEPPFNHYLGVLKTNKIXPRSYSIIPCTKYSSSIFSP 127 +P+ A+P + G + N + P+S +++P T + SI SP Sbjct: 13 LPDYADPDYFEARG--ERNPVKPQSSNVVPGTSHIGSIKSP 51 >SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1275 Score = 26.6 bits (56), Expect = 4.9 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 5/63 (7%) Frame = +3 Query: 318 PIRPIVSRITIHWPSFYNVVTGKTLALPNLIALQ-----HIPLSPAGVIAKRPAPIALPN 482 P P+ S ++ H + + +L N I+L ++PLSP A+ P+PI L + Sbjct: 172 PRPPLPSSVSSHSSPYSTTSSTSLYSLYNDISLSCSPEPYLPLSPTRSPARTPSPIRLYS 231 Query: 483 SCA 491 S A Sbjct: 232 SDA 234 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,649,559 Number of Sequences: 5004 Number of extensions: 75296 Number of successful extensions: 124 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 124 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 466510270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -