BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0704.Seq (919 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014296-2194|AAN11859.1| 1257|Drosophila melanogaster CG11006-P... 29 6.8 AE014296-2193|AAN11858.1| 1294|Drosophila melanogaster CG11006-P... 29 6.8 AE014296-2192|AAN11860.2| 1272|Drosophila melanogaster CG11006-P... 29 6.8 >AE014296-2194|AAN11859.1| 1257|Drosophila melanogaster CG11006-PB, isoform B protein. Length = 1257 Score = 29.5 bits (63), Expect = 6.8 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +3 Query: 378 TGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCA 491 TG A +L++ H PL GVI K P LP+S A Sbjct: 26 TGSLSASASLVSHSHPPLQLRGVINKYSLPSHLPSSAA 63 >AE014296-2193|AAN11858.1| 1294|Drosophila melanogaster CG11006-PC, isoform C protein. Length = 1294 Score = 29.5 bits (63), Expect = 6.8 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +3 Query: 378 TGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCA 491 TG A +L++ H PL GVI K P LP+S A Sbjct: 63 TGSLSASASLVSHSHPPLQLRGVINKYSLPSHLPSSAA 100 >AE014296-2192|AAN11860.2| 1272|Drosophila melanogaster CG11006-PD, isoform D protein. Length = 1272 Score = 29.5 bits (63), Expect = 6.8 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +3 Query: 378 TGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCA 491 TG A +L++ H PL GVI K P LP+S A Sbjct: 41 TGSLSASASLVSHSHPPLQLRGVINKYSLPSHLPSSAA 78 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 41,252,765 Number of Sequences: 53049 Number of extensions: 910527 Number of successful extensions: 1634 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1634 length of database: 24,988,368 effective HSP length: 85 effective length of database: 20,479,203 effective search space used: 4505424660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -