BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0703.Seq (577 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ237664-1|CAB40379.2| 81|Anopheles gambiae putative infection... 23 5.4 AJ001042-1|CAA04496.1| 395|Anopheles gambiae putative gram nega... 23 5.4 AF081533-1|AAD29854.1| 395|Anopheles gambiae putative gram nega... 23 5.4 AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. 23 9.4 AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. 23 9.4 AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. 23 9.4 AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. 23 9.4 AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. 23 9.4 AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. 23 9.4 AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. 23 9.4 AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. 23 9.4 AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. 23 9.4 AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CY... 23 9.4 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 23 9.4 AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. 23 9.4 >AJ237664-1|CAB40379.2| 81|Anopheles gambiae putative infection responsive shortpeptide protein. Length = 81 Score = 23.4 bits (48), Expect = 5.4 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +3 Query: 336 CQTKGGRYCGY 368 C++ G RYCGY Sbjct: 32 CKSIGARYCGY 42 >AJ001042-1|CAA04496.1| 395|Anopheles gambiae putative gram negative bacteria bindingprotein protein. Length = 395 Score = 23.4 bits (48), Expect = 5.4 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = +1 Query: 91 FFDEYDYYNFDHDKHIFTGHGG 156 F D +D+++F+ +H+ T GG Sbjct: 64 FEDNFDFFDFEKWEHVNTLAGG 85 >AF081533-1|AAD29854.1| 395|Anopheles gambiae putative gram negative bacteria bindingprotein protein. Length = 395 Score = 23.4 bits (48), Expect = 5.4 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = +1 Query: 91 FFDEYDYYNFDHDKHIFTGHGG 156 F D +D+++F+ +H+ T GG Sbjct: 64 FEDNFDFFDFEKWEHVNTLAGG 85 >AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 22.6 bits (46), Expect = 9.4 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 363 RNSVLLSFGNSIVLLLDHSCLL 298 +NS +LSF N L LD S LL Sbjct: 178 KNSAVLSFFNDEKLYLDKSGLL 199 >AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 22.6 bits (46), Expect = 9.4 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 363 RNSVLLSFGNSIVLLLDHSCLL 298 +NS +LSF N L LD S LL Sbjct: 178 KNSAVLSFFNDEKLYLDKSGLL 199 >AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 22.6 bits (46), Expect = 9.4 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 363 RNSVLLSFGNSIVLLLDHSCLL 298 +NS +LSF N L LD S LL Sbjct: 178 KNSAVLSFFNDEKLYLDKSGLL 199 >AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 22.6 bits (46), Expect = 9.4 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 363 RNSVLLSFGNSIVLLLDHSCLL 298 +NS +LSF N L LD S LL Sbjct: 178 KNSAVLSFFNDEKLYLDKSGLL 199 >AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 22.6 bits (46), Expect = 9.4 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 363 RNSVLLSFGNSIVLLLDHSCLL 298 +NS +LSF N L LD S LL Sbjct: 178 KNSAVLSFFNDEKLYLDKSGLL 199 >AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 22.6 bits (46), Expect = 9.4 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -3 Query: 254 CSAFMSFVTIFLECPXGSKWLVCSDASFLVRC 159 CS SF F E G + +CS +RC Sbjct: 47 CSCDESFFGPFCETKDGEQPALCSSYEDCIRC 78 >AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 22.6 bits (46), Expect = 9.4 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -3 Query: 254 CSAFMSFVTIFLECPXGSKWLVCSDASFLVRC 159 CS SF F E G + +CS +RC Sbjct: 47 CSCDESFFGPFCETKDGEQPALCSSYEDCIRC 78 >AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 22.6 bits (46), Expect = 9.4 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -3 Query: 254 CSAFMSFVTIFLECPXGSKWLVCSDASFLVRC 159 CS SF F E G + +CS +RC Sbjct: 47 CSCDESFFGPFCETKDGEQPALCSSYEDCIRC 78 >AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 22.6 bits (46), Expect = 9.4 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -3 Query: 254 CSAFMSFVTIFLECPXGSKWLVCSDASFLVRC 159 CS SF F E G + +CS +RC Sbjct: 47 CSCDESFFGPFCETKDGEQPALCSSYEDCIRC 78 >AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CYP12F4 protein. Length = 521 Score = 22.6 bits (46), Expect = 9.4 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +1 Query: 97 DEYDYYNFDHDKHIFTGHGG 156 D + YY H F G+GG Sbjct: 122 DSFVYYRKQHRPEYFKGYGG 141 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 22.6 bits (46), Expect = 9.4 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -3 Query: 254 CSAFMSFVTIFLECPXGSKWLVCSDASFLVRC 159 CS SF F E G + +CS +RC Sbjct: 623 CSCDESFFGPFCETKDGEQPALCSSYEDCIRC 654 >AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. Length = 576 Score = 22.6 bits (46), Expect = 9.4 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 363 RNSVLLSFGNSIVLLLDHSCLL 298 +NS +LSF N L LD S LL Sbjct: 405 KNSAVLSFFNDEKLYLDKSGLL 426 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 522,439 Number of Sequences: 2352 Number of extensions: 9675 Number of successful extensions: 20 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54665910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -