BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0700.Seq (533 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47442| Best HMM Match : Linker_histone (HMM E-Value=1.4e-36) 68 6e-12 SB_48636| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 7e-12 SB_41055| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_12695| Best HMM Match : Linker_histone (HMM E-Value=1.6e-38) 65 4e-11 SB_44588| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_41056| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 7e-11 SB_5701| Best HMM Match : Linker_histone (HMM E-Value=5.9e-39) 64 7e-11 SB_41057| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 9e-11 SB_31725| Best HMM Match : Linker_histone (HMM E-Value=1.5e-37) 59 2e-09 SB_25699| Best HMM Match : Linker_histone (HMM E-Value=1.5e-37) 59 2e-09 SB_56158| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_30056| Best HMM Match : Linker_histone (HMM E-Value=2.4e-37) 59 2e-09 SB_25960| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 3e-09 SB_17373| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 3e-09 SB_54710| Best HMM Match : Linker_histone (HMM E-Value=6e-38) 58 6e-09 SB_25704| Best HMM Match : Linker_histone (HMM E-Value=8.3e-37) 58 6e-09 SB_45217| Best HMM Match : Linker_histone (HMM E-Value=4.4e-27) 57 1e-08 SB_41054| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 6e-08 SB_18627| Best HMM Match : Histone (HMM E-Value=1.7e-30) 51 7e-07 SB_58714| Best HMM Match : Linker_histone (HMM E-Value=5.7e-15) 43 1e-04 SB_35969| Best HMM Match : B56 (HMM E-Value=3.1) 33 0.19 SB_37873| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 >SB_47442| Best HMM Match : Linker_histone (HMM E-Value=1.4e-36) Length = 650 Score = 67.7 bits (158), Expect = 6e-12 Identities = 35/63 (55%), Positives = 45/63 (71%) Frame = +3 Query: 255 SAIAELKERRXSSLQAIKKYIAAQYKVDAEKLAPFIRKYLKNAVESGTLIQTKGKGASGS 434 +AI+ LK+R SS QAI+KYI A YKV E + ++ LK AV G+++QTKG GASGS Sbjct: 491 AAISSLKDRNGSSRQAIEKYIKANYKV-GESVGVHLKMALKRAVAGGSILQTKGVGASGS 549 Query: 435 FKL 443 FKL Sbjct: 550 FKL 552 >SB_48636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 67.3 bits (157), Expect = 7e-12 Identities = 36/63 (57%), Positives = 44/63 (69%) Frame = +3 Query: 255 SAIAELKERRXSSLQAIKKYIAAQYKVDAEKLAPFIRKYLKNAVESGTLIQTKGKGASGS 434 +AI LKER SS QAI+KYI A YKV +K++ ++ LK E GTL+ TKG GASGS Sbjct: 24 TAIGALKERGGSSRQAIEKYIKANYKV-GDKVSTQLKMALKRMSEKGTLVHTKGTGASGS 82 Query: 435 FKL 443 FKL Sbjct: 83 FKL 85 >SB_41055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 65.7 bits (153), Expect = 2e-11 Identities = 35/63 (55%), Positives = 43/63 (68%) Frame = +3 Query: 255 SAIAELKERRXSSLQAIKKYIAAQYKVDAEKLAPFIRKYLKNAVESGTLIQTKGKGASGS 434 +AI LKER SS QAI+KYI A YKV + + +++ LK E GTL+ TKG GASGS Sbjct: 61 AAIDALKERSGSSRQAIEKYIKANYKV-GDNVDTYLKLALKRMSEKGTLVHTKGTGASGS 119 Query: 435 FKL 443 FKL Sbjct: 120 FKL 122 >SB_12695| Best HMM Match : Linker_histone (HMM E-Value=1.6e-38) Length = 184 Score = 64.9 bits (151), Expect = 4e-11 Identities = 35/63 (55%), Positives = 42/63 (66%) Frame = +3 Query: 255 SAIAELKERRXSSLQAIKKYIAAQYKVDAEKLAPFIRKYLKNAVESGTLIQTKGKGASGS 434 +AI LKER SS QAI+KYI A YKV +K+ ++ LK E G L+ TKG GASGS Sbjct: 26 AAIGALKERGGSSRQAIEKYIKANYKV-GDKVGAQLKMALKRMSEKGALVHTKGTGASGS 84 Query: 435 FKL 443 FKL Sbjct: 85 FKL 87 >SB_44588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 64.9 bits (151), Expect = 4e-11 Identities = 35/63 (55%), Positives = 42/63 (66%) Frame = +3 Query: 255 SAIAELKERRXSSLQAIKKYIAAQYKVDAEKLAPFIRKYLKNAVESGTLIQTKGKGASGS 434 +AI LKER SS QAI+KYI A YKV +K+ ++ LK E G L+ TKG GASGS Sbjct: 26 AAIGALKERGGSSRQAIEKYIKANYKV-GDKVGTQLKMALKRMSEKGALVHTKGTGASGS 84 Query: 435 FKL 443 FKL Sbjct: 85 FKL 87 >SB_41056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 64.1 bits (149), Expect = 7e-11 Identities = 34/63 (53%), Positives = 43/63 (68%) Frame = +3 Query: 255 SAIAELKERRXSSLQAIKKYIAAQYKVDAEKLAPFIRKYLKNAVESGTLIQTKGKGASGS 434 +AI LKER SS QAI+KYI A YKV + + +++ LK + GTL+ TKG GASGS Sbjct: 61 AAIDALKERSGSSRQAIEKYIKANYKV-GDNVDTYLKLALKRMSKKGTLVHTKGTGASGS 119 Query: 435 FKL 443 FKL Sbjct: 120 FKL 122 >SB_5701| Best HMM Match : Linker_histone (HMM E-Value=5.9e-39) Length = 370 Score = 64.1 bits (149), Expect = 7e-11 Identities = 34/63 (53%), Positives = 43/63 (68%) Frame = +3 Query: 255 SAIAELKERRXSSLQAIKKYIAAQYKVDAEKLAPFIRKYLKNAVESGTLIQTKGKGASGS 434 +AI LKER SS QAI+KYI A YKV + + +++ LK + GTL+ TKG GASGS Sbjct: 221 AAIDALKERSGSSRQAIEKYIKANYKV-GDNVDTYLKLALKRMSKKGTLVHTKGTGASGS 279 Query: 435 FKL 443 FKL Sbjct: 280 FKL 282 >SB_41057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 296 Score = 63.7 bits (148), Expect = 9e-11 Identities = 34/63 (53%), Positives = 42/63 (66%) Frame = +3 Query: 255 SAIAELKERRXSSLQAIKKYIAAQYKVDAEKLAPFIRKYLKNAVESGTLIQTKGKGASGS 434 +AI LKER SS QAI+KYI A YKV + + +++ LK E GTL+ TKG GA GS Sbjct: 147 AAIDALKERSGSSRQAIEKYIKANYKV-GDNVDTYLKLALKRMSEKGTLVHTKGTGACGS 205 Query: 435 FKL 443 FKL Sbjct: 206 FKL 208 >SB_31725| Best HMM Match : Linker_histone (HMM E-Value=1.5e-37) Length = 184 Score = 59.3 bits (137), Expect = 2e-09 Identities = 32/63 (50%), Positives = 40/63 (63%) Frame = +3 Query: 255 SAIAELKERRXSSLQAIKKYIAAQYKVDAEKLAPFIRKYLKNAVESGTLIQTKGKGASGS 434 +AI LKER SS QAI+KYI YKV + + ++ LK + G L+ TKG GASGS Sbjct: 28 AAIGALKERNGSSRQAIEKYIKGNYKV-GDGVGVHLKLALKRMSDKGKLVHTKGVGASGS 86 Query: 435 FKL 443 FKL Sbjct: 87 FKL 89 >SB_25699| Best HMM Match : Linker_histone (HMM E-Value=1.5e-37) Length = 179 Score = 59.3 bits (137), Expect = 2e-09 Identities = 32/63 (50%), Positives = 40/63 (63%) Frame = +3 Query: 255 SAIAELKERRXSSLQAIKKYIAAQYKVDAEKLAPFIRKYLKNAVESGTLIQTKGKGASGS 434 +AI LKER SS QAI+KYI YKV + + ++ LK + G L+ TKG GASGS Sbjct: 28 AAIGALKERNGSSRQAIEKYIKGNYKV-GDGVGVHLKLALKRMSDKGKLVHTKGVGASGS 86 Query: 435 FKL 443 FKL Sbjct: 87 FKL 89 >SB_56158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 59.3 bits (137), Expect = 2e-09 Identities = 34/64 (53%), Positives = 41/64 (64%) Frame = +3 Query: 252 ESAIAELKERRXSSLQAIKKYIAAQYKVDAEKLAPFIRKYLKNAVESGTLIQTKGKGASG 431 ++AI LKER SS QAI KYI A YKV + ++ LK +G+LI TKG GASG Sbjct: 25 KTAIGALKERNGSSRQAIVKYIKANYKVQ-DNADVHVKLALKRMSLAGSLIHTKGVGASG 83 Query: 432 SFKL 443 SFKL Sbjct: 84 SFKL 87 >SB_30056| Best HMM Match : Linker_histone (HMM E-Value=2.4e-37) Length = 184 Score = 59.3 bits (137), Expect = 2e-09 Identities = 32/63 (50%), Positives = 40/63 (63%) Frame = +3 Query: 255 SAIAELKERRXSSLQAIKKYIAAQYKVDAEKLAPFIRKYLKNAVESGTLIQTKGKGASGS 434 +AI LKER SS QAI+KYI YKV + + ++ LK + G L+ TKG GASGS Sbjct: 28 AAIGALKERNGSSRQAIEKYIKGNYKV-GDGVGVHLKLALKRMSDKGKLVHTKGVGASGS 86 Query: 435 FKL 443 FKL Sbjct: 87 FKL 89 >SB_25960| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 58.4 bits (135), Expect = 3e-09 Identities = 33/63 (52%), Positives = 40/63 (63%) Frame = +3 Query: 255 SAIAELKERRXSSLQAIKKYIAAQYKVDAEKLAPFIRKYLKNAVESGTLIQTKGKGASGS 434 +AI LKER SS QAI K+I A Y + A ++ LK V +G L+Q KGKGASGS Sbjct: 54 TAITSLKERGGSSRQAIAKFIKANYPAVGDPGA-HLKMALKRGVAAGRLVQPKGKGASGS 112 Query: 435 FKL 443 FKL Sbjct: 113 FKL 115 >SB_17373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 247 Score = 58.4 bits (135), Expect = 3e-09 Identities = 33/63 (52%), Positives = 39/63 (61%) Frame = +3 Query: 255 SAIAELKERRXSSLQAIKKYIAAQYKVDAEKLAPFIRKYLKNAVESGTLIQTKGKGASGS 434 +AI LKER SS QAI+KYI A YKV + ++ LK G L+ TKG GASGS Sbjct: 90 AAIGALKERGGSSRQAIEKYIKANYKVG--DVGTHLKLALKRMSAKGALVHTKGTGASGS 147 Query: 435 FKL 443 FKL Sbjct: 148 FKL 150 >SB_54710| Best HMM Match : Linker_histone (HMM E-Value=6e-38) Length = 234 Score = 57.6 bits (133), Expect = 6e-09 Identities = 32/63 (50%), Positives = 39/63 (61%) Frame = +3 Query: 255 SAIAELKERRXSSLQAIKKYIAAQYKVDAEKLAPFIRKYLKNAVESGTLIQTKGKGASGS 434 +AI LKER SS QAI+KYI YKV + + ++ LK + G L TKG GASGS Sbjct: 75 AAIGALKERNGSSRQAIEKYIKGNYKV-GDNVGVQLKLALKRMSDKGKLAHTKGVGASGS 133 Query: 435 FKL 443 FKL Sbjct: 134 FKL 136 >SB_25704| Best HMM Match : Linker_histone (HMM E-Value=8.3e-37) Length = 184 Score = 57.6 bits (133), Expect = 6e-09 Identities = 31/63 (49%), Positives = 40/63 (63%) Frame = +3 Query: 255 SAIAELKERRXSSLQAIKKYIAAQYKVDAEKLAPFIRKYLKNAVESGTLIQTKGKGASGS 434 +AI LKER SS QAI+KYI +KV + + ++ LK + G L+ TKG GASGS Sbjct: 28 AAIGALKERNGSSRQAIEKYIKGNFKV-GDGVGVHLKLALKRMSDKGKLVHTKGVGASGS 86 Query: 435 FKL 443 FKL Sbjct: 87 FKL 89 >SB_45217| Best HMM Match : Linker_histone (HMM E-Value=4.4e-27) Length = 228 Score = 56.8 bits (131), Expect = 1e-08 Identities = 33/66 (50%), Positives = 43/66 (65%), Gaps = 2/66 (3%) Frame = +3 Query: 252 ESAIAELKERRXSSLQAIKKYIAAQYKV--DAEKLAPFIRKYLKNAVESGTLIQTKGKGA 425 E AI L ER SS Q I KY+ A + V ++EKL ++ LK V+SG L++T G+GA Sbjct: 22 EEAIKRLHERGGSSRQKIVKYVQANFDVGDNSEKL---VKASLKKGVDSGRLVRTSGQGA 78 Query: 426 SGSFKL 443 SGSFKL Sbjct: 79 SGSFKL 84 >SB_41054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 54.4 bits (125), Expect = 6e-08 Identities = 33/64 (51%), Positives = 41/64 (64%), Gaps = 1/64 (1%) Frame = +3 Query: 255 SAIAELKERRXSSLQAIKKYIAAQYKVDAEKLAPFIRKYLKNAVESGTLIQ-TKGKGASG 431 +AI LKER SS QAI+KYI A YKV + + +++ LK GTL + KG GASG Sbjct: 23 AAIDALKERSGSSRQAIEKYIKANYKV-GDNVDTYLKLALKRMSGKGTLSKLEKGTGASG 81 Query: 432 SFKL 443 SFKL Sbjct: 82 SFKL 85 >SB_18627| Best HMM Match : Histone (HMM E-Value=1.7e-30) Length = 279 Score = 50.8 bits (116), Expect = 7e-07 Identities = 28/58 (48%), Positives = 35/58 (60%) Frame = +3 Query: 273 KERRXSSLQAIKKYIAAQYKVDAEKLAPFIRKYLKNAVESGTLIQTKGKGASGSFKLE 446 KER SS QAI+KYI YKV + + + LK + G L+ TK GASGSFKL+ Sbjct: 129 KERNGSSRQAIEKYIKGNYKV-GDGVGVHLNLALKRMSDKGKLVHTKVVGASGSFKLD 185 >SB_58714| Best HMM Match : Linker_histone (HMM E-Value=5.7e-15) Length = 169 Score = 43.2 bits (97), Expect = 1e-04 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 2/57 (3%) Frame = +3 Query: 282 RXSSLQAIKKYIAAQYKVDAEKLA-PFIRKYLKNA-VESGTLIQTKGKGASGSFKLE 446 + +S QAI KYI ++ + K + + LK A GTL+ KGKGA+GSFKL+ Sbjct: 27 KGASRQAINKYIVKEFNLTENKHHHTMLNQALKRASAPEGTLVHNKGKGAAGSFKLK 83 >SB_35969| Best HMM Match : B56 (HMM E-Value=3.1) Length = 174 Score = 32.7 bits (71), Expect = 0.19 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = +3 Query: 372 LKNA-VESGTLIQTKGKGASGSFKL 443 LK A GTL+ KGKGA+GSFKL Sbjct: 2 LKRASAPEGTLVHNKGKGAAGSFKL 26 >SB_37873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 27.5 bits (58), Expect = 7.3 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = +3 Query: 258 AIAELKERRXS-SLQAIKKYIAAQYKVDAEKLAPFIRKYLKNAVESGTLIQTKGKGASGS 434 A+ EL+E S S Q I + + + + + + + + AVE G +I+T G G +GS Sbjct: 15 AVRELQEYHSSVSRQKIVENVQSACR-RGKNVIRLAKLAIIKAVEVGLIIRTSGSGLNGS 73 Query: 435 F 437 F Sbjct: 74 F 74 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,551,140 Number of Sequences: 59808 Number of extensions: 206309 Number of successful extensions: 396 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 362 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 377 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1203486867 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -