BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0695.Seq (895 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 25 2.3 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 25 2.3 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 25 3.1 CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline... 25 4.1 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 24 5.4 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 25.4 bits (53), Expect = 2.3 Identities = 21/72 (29%), Positives = 28/72 (38%), Gaps = 6/72 (8%) Frame = -2 Query: 462 GWTSSQPTRC*VVTGSYRH--LQHKCATHIVTTAAPPFKPKR----ITASRQK*AGGGGT 301 G + Q RC + +H Q H+ TA + P+R I R A GGG+ Sbjct: 132 GCNAGQTNRCSSLKDLIKHGETQAVIEIHLENTAFNAYDPERYGGRIICERTLNASGGGS 191 Query: 300 YPRGLTRGPTTS 265 Y G T S Sbjct: 192 YKLKNEHGQTVS 203 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 25.4 bits (53), Expect = 2.3 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 3/34 (8%) Frame = -3 Query: 377 LQRLPRPSNRNALLL---HGRNRQGAVVPTRADS 285 LQRL R R L HGRNR+ P+ AD+ Sbjct: 1143 LQRLYRQRAREGTLPTVPHGRNRRSRSAPSEADT 1176 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 25.0 bits (52), Expect = 3.1 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +1 Query: 109 RHRSPINSIYTRARDETEPALRHS 180 RHRS + + TR + +TE A+RH+ Sbjct: 1794 RHRSLVTATKTRKKQQTE-AIRHA 1816 >CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline phosphatase protein. Length = 548 Score = 24.6 bits (51), Expect = 4.1 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 79 VSGGRRREAPRHRSPINSIYTRARDETEPALRH 177 + GGRR P H + I+ I R R + E ++H Sbjct: 267 MGGGRREFLPTHETDIDGIRGR-RTDGEDLIKH 298 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 24.2 bits (50), Expect = 5.4 Identities = 8/23 (34%), Positives = 17/23 (73%) Frame = +2 Query: 41 VQKYIQATDLSEASQEAVEEKLR 109 ++KY++ DLSE +E ++ +L+ Sbjct: 896 IEKYLKPLDLSEKQKEEMKSQLK 918 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 857,611 Number of Sequences: 2352 Number of extensions: 16935 Number of successful extensions: 27 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 96334083 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -