BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0693.Seq (497 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58297| Best HMM Match : DUF630 (HMM E-Value=6.3) 29 2.1 SB_38005| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.5 >SB_58297| Best HMM Match : DUF630 (HMM E-Value=6.3) Length = 194 Score = 29.1 bits (62), Expect = 2.1 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 2/71 (2%) Frame = -1 Query: 374 KRVQLCFRRYFLSDHFLWESK--PLHYVTRYGTRLFGFFFAHHTTAVLRTYVAPNCSYTF 201 + + ++Y +H LW + +HY+TRY TR + + T + YV C T Sbjct: 117 RAISRSLKKYRDYNHELWNNDVGQVHYMTRYVTRYGSHYVTRYFTRYVSRYVT-RC-VTR 174 Query: 200 FNLCYNFPYII 168 + + Y Y+I Sbjct: 175 YVIPYVTRYVI 185 >SB_38005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 27.5 bits (58), Expect = 6.5 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -1 Query: 347 YFLSDHFLWESKPLHYVTRYGTRLFGFFFAHHTTAVLRTYVAPN 216 YF S + P Y R FG+ +H+ L++Y+ PN Sbjct: 34 YFSSSSMSHKETPEQYARRNEIMRFGYPESHNNKYELQSYILPN 77 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,436,195 Number of Sequences: 59808 Number of extensions: 227498 Number of successful extensions: 358 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 335 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 357 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1075029208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -