BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0693.Seq (497 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC013879-1|AAH13879.1| 685|Homo sapiens polo-like kinase 2 (Dro... 30 3.9 AF223574-1|AAF62897.1| 685|Homo sapiens serum-inducible kinase ... 30 3.9 AF059617-1|AAC14573.1| 685|Homo sapiens serum-inducible kinase ... 30 3.9 >BC013879-1|AAH13879.1| 685|Homo sapiens polo-like kinase 2 (Drosophila) protein. Length = 685 Score = 30.3 bits (65), Expect = 3.9 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = -1 Query: 383 LQNKRVQLCFRRYFLSDHFLWESKPLHYVTRYGTRLFGFFFAHHTTAVL 237 L+N C + LS F W +K + Y +YG FG+ + HT VL Sbjct: 483 LENMPEADCIPKEQLSTSFQWVTKWVDYSNKYG---FGYQLSDHTVGVL 528 >AF223574-1|AAF62897.1| 685|Homo sapiens serum-inducible kinase protein. Length = 685 Score = 30.3 bits (65), Expect = 3.9 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = -1 Query: 383 LQNKRVQLCFRRYFLSDHFLWESKPLHYVTRYGTRLFGFFFAHHTTAVL 237 L+N C + LS F W +K + Y +YG FG+ + HT VL Sbjct: 483 LENMPEADCIPKEQLSTSFQWVTKWVDYSNKYG---FGYQLSDHTVGVL 528 >AF059617-1|AAC14573.1| 685|Homo sapiens serum-inducible kinase protein. Length = 685 Score = 30.3 bits (65), Expect = 3.9 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = -1 Query: 383 LQNKRVQLCFRRYFLSDHFLWESKPLHYVTRYGTRLFGFFFAHHTTAVL 237 L+N C + LS F W +K + Y +YG FG+ + HT VL Sbjct: 483 LENMPEADCIPKEQLSTSFQWVTKWVDYSNKYG---FGYQLSDHTVGVL 528 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 57,189,879 Number of Sequences: 237096 Number of extensions: 987260 Number of successful extensions: 1317 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1308 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1317 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4536472160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -