BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0693.Seq (497 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY119034-1|AAM50894.1| 174|Drosophila melanogaster LP05734p pro... 28 8.1 AY060412-1|AAL25451.1| 174|Drosophila melanogaster LD36162p pro... 28 8.1 AY051535-1|AAK92959.1| 576|Drosophila melanogaster GH18690p pro... 28 8.1 AE014296-1628|AAN11962.1| 174|Drosophila melanogaster CG4460-PB... 28 8.1 AE014296-1627|AAF50290.1| 174|Drosophila melanogaster CG4460-PA... 28 8.1 >AY119034-1|AAM50894.1| 174|Drosophila melanogaster LP05734p protein. Length = 174 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +3 Query: 261 EKEAKQPGTVTRYVMQRFTLPQEVIT*KITS 353 ++EA+Q G +R+ ++RF LP+ K+TS Sbjct: 94 QQEAEQGGYSSRHFLRRFVLPEGYEADKVTS 124 >AY060412-1|AAL25451.1| 174|Drosophila melanogaster LD36162p protein. Length = 174 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +3 Query: 261 EKEAKQPGTVTRYVMQRFTLPQEVIT*KITS 353 ++EA+Q G +R+ ++RF LP+ K+TS Sbjct: 94 QQEAEQGGYSSRHFLRRFVLPEGYEADKVTS 124 >AY051535-1|AAK92959.1| 576|Drosophila melanogaster GH18690p protein. Length = 576 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +2 Query: 200 KRYMNN*ELHTFLVPLSYGERKRSQTAWYRNALRN 304 KRY N TFL +Y ERK W R R+ Sbjct: 496 KRYYENVHYDTFLATTTYVERKERYGKWKRAVERS 530 >AE014296-1628|AAN11962.1| 174|Drosophila melanogaster CG4460-PB, isoform B protein. Length = 174 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +3 Query: 261 EKEAKQPGTVTRYVMQRFTLPQEVIT*KITS 353 ++EA+Q G +R+ ++RF LP+ K+TS Sbjct: 94 QQEAEQGGYSSRHFLRRFVLPEGYEADKVTS 124 >AE014296-1627|AAF50290.1| 174|Drosophila melanogaster CG4460-PA, isoform A protein. Length = 174 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +3 Query: 261 EKEAKQPGTVTRYVMQRFTLPQEVIT*KITS 353 ++EA+Q G +R+ ++RF LP+ K+TS Sbjct: 94 QQEAEQGGYSSRHFLRRFVLPEGYEADKVTS 124 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,595,003 Number of Sequences: 53049 Number of extensions: 316157 Number of successful extensions: 502 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 498 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 502 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1763278080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -