BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0693.Seq (497 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z36238-1|CAA85275.2| 400|Caenorhabditis elegans Hypothetical pr... 27 5.7 Z99286-2|CAH60793.1| 310|Caenorhabditis elegans Hypothetical pr... 27 10.0 >Z36238-1|CAA85275.2| 400|Caenorhabditis elegans Hypothetical protein R74.2 protein. Length = 400 Score = 27.5 bits (58), Expect = 5.7 Identities = 15/57 (26%), Positives = 24/57 (42%) Frame = -1 Query: 374 KRVQLCFRRYFLSDHFLWESKPLHYVTRYGTRLFGFFFAHHTTAVLRTYVAPNCSYT 204 KR + +RR + H+ W+ P Y+ R G + + TY P+ YT Sbjct: 130 KRPVVAYRRGYFFQHYPWDRLPRRYLLRP-----GMTYVYPPQYTFATYRYPHLPYT 181 >Z99286-2|CAH60793.1| 310|Caenorhabditis elegans Hypothetical protein Y7A9C.8 protein. Length = 310 Score = 26.6 bits (56), Expect = 10.0 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -3 Query: 213 FIYLFQFMLQFSLHYHINI*RRQRWLSGSFFIRYPQYIH 97 FI F +L FS+ ++I I R LS + + + YIH Sbjct: 187 FILFFHALLFFSMPFYIPIMISVRKLSSTQYCKVQSYIH 225 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,436,248 Number of Sequences: 27780 Number of extensions: 179462 Number of successful extensions: 322 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 320 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 322 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 945973702 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -