BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0691.Seq (914 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory recept... 23 4.4 AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory recept... 23 4.4 AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory recept... 23 4.4 S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subu... 22 7.7 AM712902-1|CAN84641.1| 95|Tribolium castaneum hypothetical pro... 22 7.7 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 22 7.7 >AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory receptor candidate 47 protein. Length = 387 Score = 22.6 bits (46), Expect = 4.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -3 Query: 315 YIIFLFRAIWLALSLLI 265 YII +R +WL+LS L+ Sbjct: 222 YIIAHYRVLWLSLSDLL 238 >AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory receptor candidate 26 protein. Length = 387 Score = 22.6 bits (46), Expect = 4.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -3 Query: 315 YIIFLFRAIWLALSLLI 265 YII +R +WL+LS L+ Sbjct: 222 YIIAHYRVLWLSLSDLL 238 >AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory receptor candidate 6 protein. Length = 387 Score = 22.6 bits (46), Expect = 4.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -3 Query: 315 YIIFLFRAIWLALSLLI 265 YII +R +WL+LS L+ Sbjct: 222 YIIAHYRVLWLSLSDLL 238 >S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subunit protein. Length = 141 Score = 21.8 bits (44), Expect = 7.7 Identities = 9/42 (21%), Positives = 20/42 (47%) Frame = -2 Query: 211 ELISLMSYGMMVICFPTGIVFFIALIFIGTVSDIIGVRIVLG 86 + + M Y ++ I P+G++ I+ + + R+ LG Sbjct: 62 QFVRSMGYYLIQIYIPSGLIVIISWVSFWLNRNATPARVALG 103 >AM712902-1|CAN84641.1| 95|Tribolium castaneum hypothetical protein protein. Length = 95 Score = 21.8 bits (44), Expect = 7.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 675 VSPDGKGDYTCGGPRPT 625 VSP G T GGP PT Sbjct: 41 VSPHVIGGITSGGPIPT 57 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.8 bits (44), Expect = 7.7 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 81 TRATLKESACSPWP 40 TR TLK + SP+P Sbjct: 256 TRTTLKNNRASPYP 269 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 236,531 Number of Sequences: 336 Number of extensions: 5670 Number of successful extensions: 12 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25547951 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -