BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0691.Seq (914 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_1299 - 35553666-35554481,35554594-35554623 33 0.24 05_01_0535 - 4610339-4610707,4611910-4613049,4613342-4613419 31 1.3 01_01_0553 - 4067921-4068180,4068437-4068455,4069101-4070225 31 1.3 11_05_0010 - 18356835-18357080,18357475-18357672,18357780-183580... 29 5.2 05_07_0328 + 29286109-29286120,29286982-29287146,29288427-292885... 29 5.2 07_03_0111 + 13535912-13535972,13536081-13536142,13536418-135365... 29 6.8 >02_05_1299 - 35553666-35554481,35554594-35554623 Length = 281 Score = 33.5 bits (73), Expect = 0.24 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = -1 Query: 827 PVPVESDLKYRSIGIXTLKCINPLHSMGR-NW*KKAVPDIWGEIPFLSSISL 675 P VE D+ Y LKC+ L M +W P +G++P LSS+SL Sbjct: 228 PQLVELDINYGDFEFVELKCLPKLRHMAYVHWDCHGDPLSFGDVPLLSSLSL 279 >05_01_0535 - 4610339-4610707,4611910-4613049,4613342-4613419 Length = 528 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/28 (46%), Positives = 22/28 (78%) Frame = -2 Query: 658 RGLYLWWPKTNGENQKEMVYGGQVKQVM 575 RGL +WP TN +QKEM++ G++++V+ Sbjct: 352 RGLLKYWPVTN--SQKEMMFLGELEEVL 377 >01_01_0553 - 4067921-4068180,4068437-4068455,4069101-4070225 Length = 467 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/28 (46%), Positives = 22/28 (78%) Frame = -2 Query: 658 RGLYLWWPKTNGENQKEMVYGGQVKQVM 575 RGL +WP TN +QKEM++ G++++V+ Sbjct: 321 RGLLKYWPVTN--SQKEMMFLGELEEVL 346 >11_05_0010 - 18356835-18357080,18357475-18357672,18357780-18358046, 18358870-18359067,18359151-18359417,18359524-18359724, 18359807-18361363,18361499-18361859,18362602-18363467 Length = 1386 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = -1 Query: 692 LSSISLCPQMVKGTILVVAQDQRGESKGDGLWGPGKASNDT 570 L S+++C +V ++ D G+ GLWG SN T Sbjct: 1110 LESVTICSNIVIHSLTFSYNDHNGDHHLAGLWGSHGGSNQT 1150 >05_07_0328 + 29286109-29286120,29286982-29287146,29288427-29288589, 29288625-29288903,29289047-29289122,29289725-29289787, 29292116-29292164,29292413-29292504,29293017-29293068, 29293209-29293271,29293382-29293431,29293941-29294016, 29294444-29294656,29294763-29294869,29294966-29295074, 29295489-29295689,29295773-29296033,29296154-29296171, 29296287-29296397,29296755-29297030,29297108-29297382, 29297814-29298165,29298371-29298655,29298715-29299261, 29301658-29301781,29301871-29301946,29302062-29302136, 29302300-29302353,29302833-29302892,29302977-29303093, 29303228-29303361,29303480-29303682,29303879-29303976, 29304358-29304461,29304537-29304702,29304803-29304925, 29305047-29305129,29305217-29305358,29305523-29305549, 29305784-29305854,29305930-29306518 Length = 2046 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/49 (26%), Positives = 27/49 (55%) Frame = -2 Query: 217 VSELISLMSYGMMVICFPTGIVFFIALIFIGTVSDIIGVRIVLGPHARY 71 + E ++ + +G +V+ P + I + GT++ +IG+ I PH +Y Sbjct: 1189 LGEFVNRLRHGSLVMRLPDSEMGQIPTVIFGTINGVIGI-IASLPHEQY 1236 >07_03_0111 + 13535912-13535972,13536081-13536142,13536418-13536510, 13537577-13537649,13537876-13538265,13538337-13538404, 13539334-13539375,13540211-13540735,13540817-13540974, 13541078-13541636,13542438-13542500,13542579-13542680, 13542779-13543096,13543175-13543267,13543489-13543590, 13543678-13543782,13544190-13544323,13545097-13545280, 13545701-13545832,13546215-13546327,13546468-13546558, 13547138-13549339 Length = 1889 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -2 Query: 910 PPPPIMPRCRAVIPLQDPDGLKGG 839 PPPP P+ A P ++P G K G Sbjct: 127 PPPPPSPKDAAADPAKEPSGSKAG 150 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,732,017 Number of Sequences: 37544 Number of extensions: 621227 Number of successful extensions: 1616 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1547 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1616 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2600672280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -