BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0691.Seq (914 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42615| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_57709| Best HMM Match : RVT_1 (HMM E-Value=0.00081) 33 0.43 SB_30350| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.74 SB_20248| Best HMM Match : GPS (HMM E-Value=1.5) 31 1.3 SB_22184| Best HMM Match : PHD (HMM E-Value=0.00011) 30 2.3 SB_46117| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_24441| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_6318| Best HMM Match : RVT_1 (HMM E-Value=0.72) 30 3.0 SB_46102| Best HMM Match : RVT_1 (HMM E-Value=2.6e-14) 30 3.0 SB_37723| Best HMM Match : RVT_1 (HMM E-Value=0.054) 30 3.0 SB_4321| Best HMM Match : Ank (HMM E-Value=0) 29 4.0 SB_50888| Best HMM Match : Glyco_hydro_20 (HMM E-Value=0) 29 5.2 SB_36940| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_8819| Best HMM Match : I-set (HMM E-Value=0) 29 6.9 SB_50799| Best HMM Match : I-set (HMM E-Value=0) 28 9.2 SB_31501| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 >SB_42615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1130 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = -2 Query: 703 KSRFYHQYLCVPRW*RGLYLWWPKTNGENQKEMVYGGQVKQV 578 K++ YH YLC+P + + W P G +E+VY G QV Sbjct: 764 KAQTYHHYLCIPAE-KPIEEWRPSELGHKLEEVVYCGDYGQV 804 >SB_57709| Best HMM Match : RVT_1 (HMM E-Value=0.00081) Length = 754 Score = 32.7 bits (71), Expect = 0.43 Identities = 22/60 (36%), Positives = 30/60 (50%) Frame = +3 Query: 87 PRTILTPIMSDTVPINIRAIKNTMPVGKHITIIP*DMRLINSLTSRVESNSESLCMKRIV 266 P TIL + P AI +P KH + D+RLI SLTS+V E L + R++ Sbjct: 316 PNTILKTFSFELAP---SAIARPLPKSKHAKTVENDVRLI-SLTSQVAKIMEGLTLSRML 371 >SB_30350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 31.9 bits (69), Expect = 0.74 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 90 WVRTRATLKESACSPWPRGPGNPLKLLRAG 1 W RTRATL P P G GN +K RAG Sbjct: 3 WGRTRATLTGQRVFPSPEGGGNLVKHRRAG 32 >SB_20248| Best HMM Match : GPS (HMM E-Value=1.5) Length = 555 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/42 (40%), Positives = 25/42 (59%) Frame = +3 Query: 141 AIKNTMPVGKHITIIP*DMRLINSLTSRVESNSESLCMKRIV 266 AI +P+ KH + D+RLI SLTS+V E L + R++ Sbjct: 475 AIARPLPMSKHAKTVENDVRLI-SLTSQVAKIMEGLTLSRML 515 >SB_22184| Best HMM Match : PHD (HMM E-Value=0.00011) Length = 634 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 5/49 (10%) Frame = +1 Query: 508 NSSPHNYYRFQ----RGHNGPAASFVSLLALPG-PHRPSPFDSPRWSWA 639 N PH+ YR + +GH G + +L++L G PH P F++ + +W+ Sbjct: 45 NDLPHSAYRLRPIMHQGH-GATTTCSTLISLSGWPHNPLTFNTDKLAWS 92 >SB_46117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/28 (57%), Positives = 17/28 (60%) Frame = -3 Query: 84 RTRATLKESACSPWPRGPGNPLKLLRAG 1 RTRATL S P P G GN +K RAG Sbjct: 8 RTRATLTVSRVFPSPEGVGNLVKHRRAG 35 >SB_24441| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 608 Score = 29.9 bits (64), Expect = 3.0 Identities = 17/42 (40%), Positives = 24/42 (57%) Frame = +3 Query: 141 AIKNTMPVGKHITIIP*DMRLINSLTSRVESNSESLCMKRIV 266 AI +P KH + D+RLI SLTS+V E L + R++ Sbjct: 404 AIARPLPKSKHAKTVENDVRLI-SLTSQVAKIMEGLTLSRML 444 >SB_6318| Best HMM Match : RVT_1 (HMM E-Value=0.72) Length = 485 Score = 29.9 bits (64), Expect = 3.0 Identities = 17/42 (40%), Positives = 24/42 (57%) Frame = +3 Query: 141 AIKNTMPVGKHITIIP*DMRLINSLTSRVESNSESLCMKRIV 266 AI +P KH + D+RLI SLTS+V E L + R++ Sbjct: 223 AIARPLPKSKHAKTVENDVRLI-SLTSQVAKIMEGLTLSRML 263 >SB_46102| Best HMM Match : RVT_1 (HMM E-Value=2.6e-14) Length = 595 Score = 29.9 bits (64), Expect = 3.0 Identities = 17/42 (40%), Positives = 24/42 (57%) Frame = +3 Query: 141 AIKNTMPVGKHITIIP*DMRLINSLTSRVESNSESLCMKRIV 266 AI +P KH + D+RLI SLTS+V E L + R++ Sbjct: 226 AIARPLPKSKHAKTVANDVRLI-SLTSQVAKIMEGLTLSRML 266 >SB_37723| Best HMM Match : RVT_1 (HMM E-Value=0.054) Length = 596 Score = 29.9 bits (64), Expect = 3.0 Identities = 17/42 (40%), Positives = 24/42 (57%) Frame = +3 Query: 141 AIKNTMPVGKHITIIP*DMRLINSLTSRVESNSESLCMKRIV 266 AI +P KH + D+RLI SLTS+V E L + R++ Sbjct: 240 AIARPLPKSKHAKTVENDVRLI-SLTSQVAKIMEGLTLSRML 280 >SB_4321| Best HMM Match : Ank (HMM E-Value=0) Length = 915 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -1 Query: 167 SNRHSILYCSNIYRDCIRHYWRKDCPGS 84 S+ H+ +Y +++DC RH W CP S Sbjct: 684 SSDHTHVYQRFLFKDCFRHPWPFYCPPS 711 >SB_50888| Best HMM Match : Glyco_hydro_20 (HMM E-Value=0) Length = 804 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +1 Query: 556 PAASFVSLLALPGPHRPSPFDSPRWSWATTSIVP 657 P A F LL PG RP F++ W+ A T ++P Sbjct: 114 PTADFKPLL--PGDSRPVLFNAENWAVAKTDVMP 145 >SB_36940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 29.1 bits (62), Expect = 5.2 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = -2 Query: 94 VLGPHARYTEGIS 56 VLGPHARYT+G++ Sbjct: 5 VLGPHARYTDGVN 17 >SB_8819| Best HMM Match : I-set (HMM E-Value=0) Length = 1789 Score = 28.7 bits (61), Expect = 6.9 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = -3 Query: 705 GNPVSIINIFVSPDGKGDYTCGGPRPTGRIKRRWSMGAR 589 G+ SI + SP+ G Y C P+G+ + + +G + Sbjct: 1284 GDTYSIRIVRTSPEDAGTYMCEATNPSGKASKNFDIGIK 1322 >SB_50799| Best HMM Match : I-set (HMM E-Value=0) Length = 1195 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -3 Query: 720 PRY-MGGNPVSIINIFVSPDGKGDYTCGGPRPTGR 619 P Y + GN +SI+N+ + +G+YTC GR Sbjct: 684 PNYDIDGNKLSIVNVQNNASYEGNYTCTADSRAGR 718 >SB_31501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1150 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +3 Query: 339 YKSNKTSNVISGALHLTCF*RIIRPVL 419 Y+ T + ISG LH +C+ RII VL Sbjct: 523 YQGGYTRDAISGWLHASCYIRIIMRVL 549 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,133,686 Number of Sequences: 59808 Number of extensions: 692652 Number of successful extensions: 1789 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1606 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1785 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2645618622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -