BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0687.Seq (911 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) 146 2e-35 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 36 0.034 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_26800| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.079 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 35 0.10 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.10 SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 33 0.24 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 33 0.24 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 33 0.24 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 33 0.24 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 33 0.24 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 33 0.24 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 33 0.24 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 33 0.24 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 33 0.24 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 33 0.24 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 33 0.24 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 33 0.24 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 33 0.24 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 33 0.24 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 33 0.24 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 33 0.24 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 33 0.24 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 33 0.24 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 33 0.24 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 33 0.24 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 33 0.24 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 33 0.24 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 33 0.24 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 33 0.24 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 33 0.24 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 33 0.24 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 33 0.24 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 33 0.24 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 33 0.24 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 33 0.24 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 33 0.24 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 33 0.24 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 33 0.24 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 33 0.24 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 33 0.24 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 33 0.24 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 33 0.24 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 33 0.24 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 33 0.24 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 33 0.24 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 33 0.24 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 33 0.24 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 33 0.24 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 33 0.24 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 33 0.24 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 33 0.24 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 33 0.24 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 33 0.24 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 33 0.24 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) 33 0.24 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 33 0.24 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 33 0.24 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 33 0.24 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 33 0.24 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 33 0.24 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 33 0.24 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 33 0.24 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 33 0.24 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 33 0.24 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 33 0.24 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 33 0.24 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 33 0.24 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 33 0.24 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_30113| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 33 0.24 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 33 0.24 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 33 0.24 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_29000| Best HMM Match : DUF551 (HMM E-Value=2.2) 33 0.24 SB_28961| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 33 0.24 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 33 0.24 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 33 0.24 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 33 0.24 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_26380| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_26309| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_25848| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_25610| Best HMM Match : MAT_Alpha1 (HMM E-Value=7.2) 33 0.24 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) 33 0.24 SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_25265| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 >SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) Length = 322 Score = 147 bits (355), Expect = 2e-35 Identities = 65/84 (77%), Positives = 75/84 (89%) Frame = -3 Query: 252 FAPANITTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRRGYVAGDSKNNPPKGAAD 73 F+P+NITTEVKSVEMHHE+L EA+PGDNVGFNVKNVSVK+++RG VAGD KNNPPK Sbjct: 139 FSPSNITTEVKSVEMHHESLAEALPGDNVGFNVKNVSVKDIKRGNVAGDFKNNPPKPCKS 198 Query: 72 FTAQVIVLNHPGQISNGYTPVLDC 1 FTAQVIV+NHPG+I GY+PVLDC Sbjct: 199 FTAQVIVMNHPGEIHAGYSPVLDC 222 Score = 120 bits (290), Expect = 1e-27 Identities = 57/85 (67%), Positives = 66/85 (77%), Gaps = 6/85 (7%) Frame = -1 Query: 491 NMLEPSTKMPWFKGWQVER------KEGKADGKCLIEALDAILPPARPTDKPLRLPLQDV 330 NM+ +++MPWFK W +ER KE A G L E LD+ILPP+RP+ PLRLPLQDV Sbjct: 53 NMITGTSQMPWFKQWTIERVDPATKKEANASGVTLFEGLDSILPPSRPSGLPLRLPLQDV 112 Query: 329 YKIGGIGTVPVGRVETGVLKPGTIV 255 YKIGGIGTVPVGRVETGVLKPGT+V Sbjct: 113 YKIGGIGTVPVGRVETGVLKPGTVV 137 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = -2 Query: 778 IGSGXLXIXPVGXKGXVLASRLKLGKXQGFPSHDVVK 668 IG+G I P G KG VL LKLGK QGFPSHDVVK Sbjct: 51 IGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVK 87 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 49.2 bits (112), Expect = 5e-06 Identities = 22/32 (68%), Positives = 24/32 (75%) Frame = +1 Query: 646 LTIHWPSF*QRRDWENPGVXPTLIGLPAHXPF 741 +TIHWPSF +RRDWENPGV L L AH PF Sbjct: 25 ITIHWPSFYKRRDWENPGVN-QLNRLAAHPPF 55 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 48.0 bits (109), Expect = 1e-05 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +1 Query: 646 LTIHWPSF*QRRDWENPGVXPTLIGLPAHXPF 741 +TIHWPS QRRDWENPGV L L AH PF Sbjct: 280 ITIHWPSVLQRRDWENPGV-TQLNRLAAHPPF 310 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/35 (57%), Positives = 22/35 (62%) Frame = -1 Query: 776 RXXPSXYXASWXKGXCAGKPIKVGXTPGFSQSRRC 672 R P Y ASW KG CA + + TPGFSQSRRC Sbjct: 70 RCGPLRYYASWRKGGCAARRLS-WVTPGFSQSRRC 103 >SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 41.5 bits (93), Expect = 0.001 Identities = 20/38 (52%), Positives = 21/38 (55%) Frame = -1 Query: 785 KPXRXXPSXYXASWXKGXCAGKPIKVGXTPGFSQSRRC 672 K R P Y ASW KG + G TPGFSQSRRC Sbjct: 36 KGDRCGPLRYYASWRKGDATASRLS-GATPGFSQSRRC 72 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/42 (50%), Positives = 23/42 (54%) Frame = -1 Query: 797 QXLXKPXRXXPSXYXASWXKGXCAGKPIKVGXTPGFSQSRRC 672 Q L K R P Y ASW KG + + TPGFSQSRRC Sbjct: 3 QLLGKGDRCGPLRYYASWRKGDVLQRRLS-WVTPGFSQSRRC 43 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/32 (59%), Positives = 20/32 (62%) Frame = +1 Query: 646 LTIHWPSF*QRRDWENPGVXPTLIGLPAHXPF 741 +TIHWPSF WENPGV L L AH PF Sbjct: 4 ITIHWPSFYNVVHWENPGV-TQLNRLAAHPPF 34 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/52 (44%), Positives = 26/52 (50%) Frame = +2 Query: 668 FNNVVTGKTLXFXQL*SACQHXPLXANWXNXXXAXXDXASPTVXXLEMGNWE 823 F NVVTGKTL L A QH P A+W N A D S + L G W+ Sbjct: 11 FYNVVTGKTLALPNL-IALQHIPPFASWRNSEEARTDRPSQQLRSLN-GEWD 60 >SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/35 (54%), Positives = 22/35 (62%) Frame = +2 Query: 653 FTGRRFNNVVTGKTLXFXQL*SACQHXPLXANWXN 757 +TGRRF +VTGKTL L A QH P A+W N Sbjct: 54 WTGRRFTTLVTGKTLALPNL-IALQHIPHFASWRN 87 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 37.1 bits (82), Expect = 0.020 Identities = 17/34 (50%), Positives = 21/34 (61%) Frame = -2 Query: 769 GXLXIXPVGXKGXVLASRLKLGKXQGFPSHDVVK 668 G I P G +G + +KLG +GFPSHDVVK Sbjct: 12 GLFAITPAGERG-MCCKAIKLGNAKGFPSHDVVK 44 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = -3 Query: 741 KRGMCWQAD*SWXNXRVFPVTTLLKRRPVNC 649 +RGMC +A N + FP ++KRRPVNC Sbjct: 21 ERGMCCKAI-KLGNAKGFPSHDVVKRRPVNC 50 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 37.1 bits (82), Expect = 0.020 Identities = 22/52 (42%), Positives = 25/52 (48%) Frame = +2 Query: 668 FNNVVTGKTLXFXQL*SACQHXPLXANWXNXXXAXXDXASPTVXXLEMGNWE 823 F NVVTGKTL QL H P A+W N A D S + L G W+ Sbjct: 11 FYNVVTGKTLSVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLRSLN-GEWD 60 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 36.3 bits (80), Expect = 0.034 Identities = 22/51 (43%), Positives = 24/51 (47%) Frame = +2 Query: 668 FNNVVTGKTLXFXQL*SACQHXPLXANWXNXXXAXXDXASPTVXXLEMGNW 820 F NVVTGKTL QL H P A+W N A D S + L G W Sbjct: 9 FYNVVTGKTLGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLRSLN-GEW 57 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 36.3 bits (80), Expect = 0.034 Identities = 21/52 (40%), Positives = 25/52 (48%) Frame = +2 Query: 668 FNNVVTGKTLXFXQL*SACQHXPLXANWXNXXXAXXDXASPTVXXLEMGNWE 823 F NVVTGKTL L + H P A+W N A D S + L G W+ Sbjct: 11 FYNVVTGKTLALPNLIALAAHPPF-ASWRNSEEARTDRPSQQLRSLN-GEWD 60 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +1 Query: 646 LTIHWPSF*QRRDWENPGVXPTLIGLPAHXPF 741 +TIHWPSF + + P LI L AH PF Sbjct: 4 ITIHWPSFYNVVTGKTLAL-PNLIALAAHPPF 34 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 36.3 bits (80), Expect = 0.034 Identities = 16/34 (47%), Positives = 21/34 (61%) Frame = -2 Query: 778 IGSGXLXIXPVGXKGXVLASRLKLGKXQGFPSHD 677 IG+G I P G +G + +KLG +GFPSHD Sbjct: 48 IGAGLFAITPAGERG-MCCKAIKLGNARGFPSHD 80 Score = 28.7 bits (61), Expect = 6.9 Identities = 16/31 (51%), Positives = 18/31 (58%) Frame = -3 Query: 741 KRGMCWQAD*SWXNXRVFPVTTLLKRRPVNC 649 +RGMC +A N R FP KRRPVNC Sbjct: 60 ERGMCCKAI-KLGNARGFPSHDGEKRRPVNC 89 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 35.9 bits (79), Expect = 0.045 Identities = 19/38 (50%), Positives = 20/38 (52%) Frame = -1 Query: 785 KPXRXXPSXYXASWXKGXCAGKPIKVGXTPGFSQSRRC 672 K R P Y ASW KG + TPGFSQSRRC Sbjct: 7 KGDRCGPLRYYASWRKGDVLQGRLS-WVTPGFSQSRRC 43 >SB_26800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 35.1 bits (77), Expect = 0.079 Identities = 18/32 (56%), Positives = 21/32 (65%) Frame = +2 Query: 656 TGRRFNNVVTGKTLXFXQL*SACQHXPLXANW 751 TGRR +VVTGKTL L +A QH P A+W Sbjct: 8 TGRRVYDVVTGKTLAVPSL-NALQHIPHFASW 38 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/52 (38%), Positives = 24/52 (46%) Frame = +2 Query: 668 FNNVVTGKTLXFXQL*SACQHXPLXANWXNXXXAXXDXASPTVXXLEMGNWE 823 F N TGKTL + QL H P A+W N A D S + L G W+ Sbjct: 54 FYNAPTGKTLAYTQLNRLAAHPPF-ASWRNSQEARADRPSQQLRSLN-GEWD 103 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 34.7 bits (76), Expect = 0.10 Identities = 22/52 (42%), Positives = 25/52 (48%) Frame = +2 Query: 668 FNNVVTGKTLXFXQL*SACQHXPLXANWXNXXXAXXDXASPTVXXLEMGNWE 823 F NVVTGKTL L A Q P A+W N A D S + L G W+ Sbjct: 11 FYNVVTGKTLALPNL-IALQLHPPFASWRNSEEARTDRPSQRLRSLN-GEWD 60 >SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +1 Query: 667 F*QRRDWENPGVXPTLIGLPAHXPF 741 F QRRDWENPGV L L AH PF Sbjct: 68 FLQRRDWENPGV-TQLNRLAAHPPF 91 >SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +1 Query: 667 F*QRRDWENPGVXPTLIGLPAHXPF 741 F QRRDWENPGV L L AH PF Sbjct: 11 FLQRRDWENPGV-TQLNRLAAHPPF 34 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 34.3 bits (75), Expect = 0.14 Identities = 22/46 (47%), Positives = 24/46 (52%) Frame = -3 Query: 786 EAXSXXAXXLLXQLAKRGMCWQAD*SWXNXRVFPVTTLLKRRPVNC 649 E S A LL QLAK G C SW FP ++KRRPVNC Sbjct: 28 EGRSVRASSLLRQLAKGG-CAARRLSWVTPG-FPSHDVVKRRPVNC 71 >SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 33.9 bits (74), Expect = 0.18 Identities = 21/47 (44%), Positives = 26/47 (55%) Frame = -1 Query: 740 KGXCAGKPIKVGXTPGFSQSRRC*NDGQ*IVNTTHYXANWLPGPPLE 600 KG CA + + TPGFSQSRRC + V + H + L PPLE Sbjct: 22 KGGCAARRLS-WVTPGFSQSRRC---KRRPVPSLHACRSTLEDPPLE 64 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 40 QRRDWENPGV-TQLNRLAAHPPF 61 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 20 QRRDWENPGV-TQLNRLAAHPPF 41 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 67 QRRDWENPGV-TQLNRLAAHPPF 88 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 49 QRRDWENPGV-TQLNRLAAHPPF 70 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 41 QRRDWENPGV-TQLNRLAAHPPF 62 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 67 QRRDWENPGV-TQLNRLAAHPPF 88 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 72 QRRDWENPGV-TQLNRLAAHPPF 93 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 43 QRRDWENPGV-TQLNRLAAHPPF 64 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 63 QRRDWENPGV-TQLNRLAAHPPF 84 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 75 QRRDWENPGV-TQLNRLAAHPPF 96 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 51 QRRDWENPGV-TQLNRLAAHPPF 72 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 40 QRRDWENPGV-TQLNRLAAHPPF 61 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 30 QRRDWENPGV-TQLNRLAAHPPF 51 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 55 QRRDWENPGV-TQLNRLAAHPPF 76 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 64 QRRDWENPGV-TQLNRLAAHPPF 85 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 58 QRRDWENPGV-TQLNRLAAHPPF 79 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 74 QRRDWENPGV-TQLNRLAAHPPF 95 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 62 QRRDWENPGV-TQLNRLAAHPPF 83 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 45 QRRDWENPGV-TQLNRLAAHPPF 66 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 221 QRRDWENPGV-TQLNRLAAHPPF 242 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 116 QRRDWENPGV-TQLNRLAAHPPF 137 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 54 QRRDWENPGV-TQLNRLAAHPPF 75 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 33 QRRDWENPGV-TQLNRLAAHPPF 54 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 21 QRRDWENPGV-TQLNRLAAHPPF 42 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 52 QRRDWENPGV-TQLNRLAAHPPF 73 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 386 QRRDWENPGV-TQLNRLAAHPPF 407 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 112 QRRDWENPGV-TQLNRLAAHPPF 133 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 88 QRRDWENPGV-TQLNRLAAHPPF 109 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 44 QRRDWENPGV-TQLNRLAAHPPF 65 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 13 QRRDWENPGV-TQLNRLAAHPPF 34 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 23 QRRDWENPGV-TQLNRLAAHPPF 44 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 43 QRRDWENPGV-TQLNRLAAHPPF 64 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 108 QRRDWENPGV-TQLNRLAAHPPF 129 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 50 QRRDWENPGV-TQLNRLAAHPPF 71 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 345 QRRDWENPGV-TQLNRLAAHPPF 366 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 85 QRRDWENPGV-TQLNRLAAHPPF 106 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 55 QRRDWENPGV-TQLNRLAAHPPF 76 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 21 QRRDWENPGV-TQLNRLAAHPPF 42 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 64 QRRDWENPGV-TQLNRLAAHPPF 85 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 48 QRRDWENPGV-TQLNRLAAHPPF 69 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 139 QRRDWENPGV-TQLNRLAAHPPF 160 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 68 QRRDWENPGV-TQLNRLAAHPPF 89 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 44 QRRDWENPGV-TQLNRLAAHPPF 65 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 148 QRRDWENPGV-TQLNRLAAHPPF 169 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 838 QRRDWENPGV-TQLNRLAAHPPF 859 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 21 QRRDWENPGV-TQLNRLAAHPPF 42 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 65 QRRDWENPGV-TQLNRLAAHPPF 86 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 39 QRRDWENPGV-TQLNRLAAHPPF 60 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 78 QRRDWENPGV-TQLNRLAAHPPF 99 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 72 QRRDWENPGV-TQLNRLAAHPPF 93 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 61 QRRDWENPGV-TQLNRLAAHPPF 82 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 74 QRRDWENPGV-TQLNRLAAHPPF 95 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 261 QRRDWENPGV-TQLNRLAAHPPF 282 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 119 QRRDWENPGV-TQLNRLAAHPPF 140 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 55 QRRDWENPGV-TQLNRLAAHPPF 76 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 41 QRRDWENPGV-TQLNRLAAHPPF 62 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 42 QRRDWENPGV-TQLNRLAAHPPF 63 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 106 QRRDWENPGV-TQLNRLAAHPPF 127 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 119 QRRDWENPGV-TQLNRLAAHPPF 140 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 44 QRRDWENPGV-TQLNRLAAHPPF 65 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 25 QRRDWENPGV-TQLNRLAAHPPF 46 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 63 QRRDWENPGV-TQLNRLAAHPPF 84 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 42 QRRDWENPGV-TQLNRLAAHPPF 63 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 39 QRRDWENPGV-TQLNRLAAHPPF 60 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 16 QRRDWENPGV-TQLNRLAAHPPF 37 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 24 QRRDWENPGV-TQLNRLAAHPPF 45 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 401 QRRDWENPGV-TQLNRLAAHPPF 422 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 50 QRRDWENPGV-TQLNRLAAHPPF 71 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 59 QRRDWENPGV-TQLNRLAAHPPF 80 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 41 QRRDWENPGV-TQLNRLAAHPPF 62 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 124 QRRDWENPGV-TQLNRLAAHPPF 145 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 60 QRRDWENPGV-TQLNRLAAHPPF 81 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 70 QRRDWENPGV-TQLNRLAAHPPF 91 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 73 QRRDWENPGV-TQLNRLAAHPPF 94 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 419 QRRDWENPGV-TQLNRLAAHPPF 440 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 116 QRRDWENPGV-TQLNRLAAHPPF 137 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 72 QRRDWENPGV-TQLNRLAAHPPF 93 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 61 QRRDWENPGV-TQLNRLAAHPPF 82 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 51 QRRDWENPGV-TQLNRLAAHPPF 72 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 54 QRRDWENPGV-TQLNRLAAHPPF 75 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 166 QRRDWENPGV-TQLNRLAAHPPF 187 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 70 QRRDWENPGV-TQLNRLAAHPPF 91 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 57 QRRDWENPGV-TQLNRLAAHPPF 78 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 93 QRRDWENPGV-TQLNRLAAHPPF 114 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 42 QRRDWENPGV-TQLNRLAAHPPF 63 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 68 QRRDWENPGV-TQLNRLAAHPPF 89 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 47 QRRDWENPGV-TQLNRLAAHPPF 68 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 190 QRRDWENPGV-TQLNRLAAHPPF 211 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 39 QRRDWENPGV-TQLNRLAAHPPF 60 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 45 QRRDWENPGV-TQLNRLAAHPPF 66 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 59 QRRDWENPGV-TQLNRLAAHPPF 80 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 56 QRRDWENPGV-TQLNRLAAHPPF 77 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 39 QRRDWENPGV-TQLNRLAAHPPF 60 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 40 QRRDWENPGV-TQLNRLAAHPPF 61 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 54 QRRDWENPGV-TQLNRLAAHPPF 75 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 44 QRRDWENPGV-TQLNRLAAHPPF 65 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 137 QRRDWENPGV-TQLNRLAAHPPF 158 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 46 QRRDWENPGV-TQLNRLAAHPPF 67 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 89 QRRDWENPGV-TQLNRLAAHPPF 110 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 27 QRRDWENPGV-TQLNRLAAHPPF 48 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 158 QRRDWENPGV-TQLNRLAAHPPF 179 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 345 QRRDWENPGV-TQLNRLAAHPPF 366 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 62 QRRDWENPGV-TQLNRLAAHPPF 83 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 26 QRRDWENPGV-TQLNRLAAHPPF 47 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 52 QRRDWENPGV-TQLNRLAAHPPF 73 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 114 QRRDWENPGV-TQLNRLAAHPPF 135 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 91 QRRDWENPGV-TQLNRLAAHPPF 112 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 41 QRRDWENPGV-TQLNRLAAHPPF 62 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 65 QRRDWENPGV-TQLNRLAAHPPF 86 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 299 QRRDWENPGV-TQLNRLAAHPPF 320 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 62 QRRDWENPGV-TQLNRLAAHPPF 83 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 63 QRRDWENPGV-TQLNRLAAHPPF 84 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 21 QRRDWENPGV-TQLNRLAAHPPF 42 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 41 QRRDWENPGV-TQLNRLAAHPPF 62 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 416 QRRDWENPGV-TQLNRLAAHPPF 437 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 100 QRRDWENPGV-TQLNRLAAHPPF 121 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 56 QRRDWENPGV-TQLNRLAAHPPF 77 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 48 QRRDWENPGV-TQLNRLAAHPPF 69 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 98 QRRDWENPGV-TQLNRLAAHPPF 119 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 48 QRRDWENPGV-TQLNRLAAHPPF 69 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 216 QRRDWENPGV-TQLNRLAAHPPF 237 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 48 QRRDWENPGV-TQLNRLAAHPPF 69 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 218 QRRDWENPGV-TQLNRLAAHPPF 239 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 38 QRRDWENPGV-TQLNRLAAHPPF 59 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 53 QRRDWENPGV-TQLNRLAAHPPF 74 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 43 QRRDWENPGV-TQLNRLAAHPPF 64 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 48 QRRDWENPGV-TQLNRLAAHPPF 69 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 152 QRRDWENPGV-TQLNRLAAHPPF 173 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 50 QRRDWENPGV-TQLNRLAAHPPF 71 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 40 QRRDWENPGV-TQLNRLAAHPPF 61 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 60 QRRDWENPGV-TQLNRLAAHPPF 81 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 45 QRRDWENPGV-TQLNRLAAHPPF 66 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 80 QRRDWENPGV-TQLNRLAAHPPF 101 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 200 QRRDWENPGV-TQLNRLAAHPPF 221 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 58 QRRDWENPGV-TQLNRLAAHPPF 79 >SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 37 QRRDWENPGV-TQLNRLAAHPPF 58 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 91 QRRDWENPGV-TQLNRLAAHPPF 112 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 27 QRRDWENPGV-TQLNRLAAHPPF 48 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 54 QRRDWENPGV-TQLNRLAAHPPF 75 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 192 QRRDWENPGV-TQLNRLAAHPPF 213 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 62 QRRDWENPGV-TQLNRLAAHPPF 83 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 72 QRRDWENPGV-TQLNRLAAHPPF 93 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 55 QRRDWENPGV-TQLNRLAAHPPF 76 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 62 QRRDWENPGV-TQLNRLAAHPPF 83 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 105 QRRDWENPGV-TQLNRLAAHPPF 126 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 81 QRRDWENPGV-TQLNRLAAHPPF 102 >SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 101 QRRDWENPGV-TQLNRLAAHPPF 122 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 78 QRRDWENPGV-TQLNRLAAHPPF 99 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 45 QRRDWENPGV-TQLNRLAAHPPF 66 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 54 QRRDWENPGV-TQLNRLAAHPPF 75 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 668 QRRDWENPGV-TQLNRLAAHPPF 689 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 53 QRRDWENPGV-TQLNRLAAHPPF 74 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 42 QRRDWENPGV-TQLNRLAAHPPF 63 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 33 QRRDWENPGV-TQLNRLAAHPPF 54 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 151 QRRDWENPGV-TQLNRLAAHPPF 172 >SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 43 QRRDWENPGV-TQLNRLAAHPPF 64 >SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 64 QRRDWENPGV-TQLNRLAAHPPF 85 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 93 QRRDWENPGV-TQLNRLAAHPPF 114 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 41 QRRDWENPGV-TQLNRLAAHPPF 62 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 105 QRRDWENPGV-TQLNRLAAHPPF 126 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 48 QRRDWENPGV-TQLNRLAAHPPF 69 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 1195 QRRDWENPGV-TQLNRLAAHPPF 1216 >SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 47 QRRDWENPGV-TQLNRLAAHPPF 68 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 37 QRRDWENPGV-TQLNRLAAHPPF 58 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 130 QRRDWENPGV-TQLNRLAAHPPF 151 >SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 61 QRRDWENPGV-TQLNRLAAHPPF 82 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 82 QRRDWENPGV-TQLNRLAAHPPF 103 >SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 55 QRRDWENPGV-TQLNRLAAHPPF 76 >SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 131 QRRDWENPGV-TQLNRLAAHPPF 152 >SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 173 QRRDWENPGV-TQLNRLAAHPPF 194 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 36 QRRDWENPGV-TQLNRLAAHPPF 57 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 85 QRRDWENPGV-TQLNRLAAHPPF 106 >SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 35 QRRDWENPGV-TQLNRLAAHPPF 56 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 50 QRRDWENPGV-TQLNRLAAHPPF 71 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 21 QRRDWENPGV-TQLNRLAAHPPF 42 >SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) Length = 496 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 80 QRRDWENPGV-TQLNRLAAHPPF 101 >SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 930 QRRDWENPGV-TQLNRLAAHPPF 951 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 349 QRRDWENPGV-TQLNRLAAHPPF 370 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 39 QRRDWENPGV-TQLNRLAAHPPF 60 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 41 QRRDWENPGV-TQLNRLAAHPPF 62 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 51 QRRDWENPGV-TQLNRLAAHPPF 72 >SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 41 QRRDWENPGV-TQLNRLAAHPPF 62 >SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 101 QRRDWENPGV-TQLNRLAAHPPF 122 >SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) Length = 718 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 358 QRRDWENPGV-TQLNRLAAHPPF 379 >SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 88 QRRDWENPGV-TQLNRLAAHPPF 109 >SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 70 QRRDWENPGV-TQLNRLAAHPPF 91 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 80 QRRDWENPGV-TQLNRLAAHPPF 101 >SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 34 QRRDWENPGV-TQLNRLAAHPPF 55 >SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) Length = 227 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 13 QRRDWENPGV-TQLNRLAAHPPF 34 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 673 QRRDWENPGVXPTLIGLPAHXPF 741 QRRDWENPGV L L AH PF Sbjct: 66 QRRDWENPGV-TQLNRLAAHPPF 87 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,219,392 Number of Sequences: 59808 Number of extensions: 663336 Number of successful extensions: 6010 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4277 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5992 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2633701421 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -