BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0686.Seq (803 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g12810.1 68416.m01598 SNF2 domain-containing protein / helica... 29 4.8 At1g79720.1 68414.m09298 aspartyl protease family protein contai... 28 8.3 >At3g12810.1 68416.m01598 SNF2 domain-containing protein / helicase domain-containing protein similar to transcriptional activator SRCAP [Homo sapiens] GI:5106572; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2055 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = +1 Query: 349 HMGRYHHPTYFC---REXVMRFGLKGXAAVVTILNLRT 453 + GRY HP Y C RE + R L + V NL T Sbjct: 1709 YRGRYRHPAYCCERYRELIQRHILSASDSAVNEKNLNT 1746 >At1g79720.1 68414.m09298 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 484 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +1 Query: 568 PVYHYIKLSKVNYIVTIYIGPYTSGPXIQTEPDSQCDSCQ 687 P+ IKL +NYIVT+ +G + T D CQ Sbjct: 123 PLTSGIKLESLNYIVTVELGGKNMSLIVDTGSDLTWVQCQ 162 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,745,169 Number of Sequences: 28952 Number of extensions: 273769 Number of successful extensions: 478 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 454 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 478 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1824072800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -