BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0673.Seq (268 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40420| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.036 SB_11380| Best HMM Match : Cathelicidins (HMM E-Value=9.6) 30 0.34 SB_46036| Best HMM Match : PSRT (HMM E-Value=1) 29 0.45 SB_22466| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.59 SB_29783| Best HMM Match : PA14 (HMM E-Value=5e-05) 29 0.59 SB_54828| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_53018| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_49027| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_43801| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_36335| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_34446| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_30555| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_30421| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_29961| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_27334| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_26172| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_10125| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_8324| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_6437| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_6297| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_4512| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_1263| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_59770| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_59175| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_51965| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_48984| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_48941| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_47625| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_45187| Best HMM Match : Sulfolobus_pRN (HMM E-Value=0.95) 29 0.78 SB_43908| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_38656| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_38497| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_38371| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_38049| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_34847| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_27307| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_26275| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_25093| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_23631| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_19329| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_18891| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_17342| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_16538| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_14423| Best HMM Match : Attractin (HMM E-Value=7) 29 0.78 SB_11715| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_9762| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_7799| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_3610| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_2425| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) 28 1.0 SB_9131| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_55897| Best HMM Match : RVT_1 (HMM E-Value=5.3e-37) 28 1.4 SB_50942| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.4 SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11) 28 1.4 SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.4 SB_27207| Best HMM Match : eIF-5a (HMM E-Value=3.1e-15) 28 1.4 SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) 28 1.4 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 28 1.4 SB_39271| Best HMM Match : Secretin_N (HMM E-Value=2.4) 28 1.4 SB_35785| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.4 SB_31551| Best HMM Match : RVT_1 (HMM E-Value=5.3e-37) 28 1.4 SB_27585| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.4 SB_18117| Best HMM Match : rve (HMM E-Value=1.7e-29) 28 1.4 SB_14634| Best HMM Match : ATP-synt_E (HMM E-Value=2.6) 28 1.4 SB_12900| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.4 SB_9508| Best HMM Match : Secretin_N (HMM E-Value=1.8) 28 1.4 SB_30799| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_28307| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.4 SB_18330| Best HMM Match : rve (HMM E-Value=1.2e-16) 27 2.4 SB_51136| Best HMM Match : Lac_bphage_repr (HMM E-Value=2.1) 27 3.1 SB_6210| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_35492| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_48283| Best HMM Match : ABC-3 (HMM E-Value=2.4) 26 5.5 SB_58829| Best HMM Match : HC2 (HMM E-Value=5.8) 25 7.3 SB_44281| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.3 SB_38920| Best HMM Match : Tetraspannin (HMM E-Value=3.5e-07) 25 7.3 SB_26839| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.3 SB_23790| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.3 SB_9571| Best HMM Match : Plasmodium_HRP (HMM E-Value=6.2) 25 7.3 SB_33873| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.3 SB_28991| Best HMM Match : EGF_2 (HMM E-Value=2.9e-06) 25 9.6 SB_13793| Best HMM Match : Helicase_C (HMM E-Value=5.6) 25 9.6 SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.6 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.6 SB_16796| Best HMM Match : Multi_Drug_Res (HMM E-Value=0.96) 25 9.6 >SB_40420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 39 Score = 33.1 bits (72), Expect = 0.036 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = -1 Query: 253 CTAPVKLPAWQCPRTGSRGSFKRRRAFPPRHHSAR 149 C AP KLP WQC R GS KR P R + R Sbjct: 2 CAAPAKLPTWQCLRHGS--VCKRETLNPERDLAVR 34 >SB_11380| Best HMM Match : Cathelicidins (HMM E-Value=9.6) Length = 149 Score = 29.9 bits (64), Expect = 0.34 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPD 205 +VPPQ NSPPGSV + + Sbjct: 88 DVPPQPNSPPGSVFDTE 104 >SB_46036| Best HMM Match : PSRT (HMM E-Value=1) Length = 878 Score = 29.5 bits (63), Expect = 0.45 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = -1 Query: 205 SRGSFKRRRAFPPRHHSARLERNTVRPPILSTAHR 101 SRG + PPR R E N+V PP S R Sbjct: 293 SRGKREENSVSPPRRSKGRREENSVSPPRRSKGRR 327 Score = 26.6 bits (56), Expect = 3.1 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -1 Query: 217 PRTGSRGSFKRRRAFPPRHHSARLERNTVRPP 122 P S+G + PPR R E N+V PP Sbjct: 304 PPRRSKGRREENSVSPPRRSKGRREDNSVSPP 335 Score = 25.0 bits (52), Expect = 9.6 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -1 Query: 172 PPRHHSARLERNTVRPPILSTAHR 101 PPR R E N+V PP S R Sbjct: 260 PPRRSKGRREENSVSPPRRSKGKR 283 >SB_22466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 29.1 bits (62), Expect = 0.59 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NSPP SV + D + Sbjct: 101 DVPPQPNSPPDSVFDTDRS 119 >SB_29783| Best HMM Match : PA14 (HMM E-Value=5e-05) Length = 1395 Score = 29.1 bits (62), Expect = 0.59 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = -1 Query: 244 PVKLPAWQCPRTGSRGSFKRRRAF-PPRHHSARLERNTVRPPILSTAHRFRPTE 86 P + W C T G+F ++R PPR +S R+ P S AH +R E Sbjct: 1138 PTQGDMWVCSPT-KMGAFVQQRLIEPPRKNSPRMSATIRFDPDPSVAHGYRKQE 1190 >SB_54828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_53018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_49027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_43801| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_36335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_34446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_30555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 88 DVPPQPNSQPGSVFDTDRS 106 >SB_30421| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_29961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_27334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_26172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 88 DVPPQPNSQPGSVFDTDRS 106 >SB_10125| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_8324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_6437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 88 DVPPQPNSQPGSVFDTDRS 106 >SB_6297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_4512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_1263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_59770| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_59175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_51965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_48984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_48941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 88 DVPPQPNSQPGSVFDTDRS 106 >SB_47625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_45187| Best HMM Match : Sulfolobus_pRN (HMM E-Value=0.95) Length = 108 Score = 28.7 bits (61), Expect = 0.78 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -3 Query: 254 MYRPSQTPRLAVSSNRI 204 M RPSQTP L VSS RI Sbjct: 70 MCRPSQTPNLTVSSTRI 86 >SB_43908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_38656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_38497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_38371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 140 DVPPQPNSQPGSVFDTDRS 158 >SB_38049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 88 DVPPQPNSQPGSVFDTDRS 106 >SB_34847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 88 DVPPQPNSQPGSVFDTDRS 106 >SB_27307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 140 DVPPQPNSQPGSVFDTDRS 158 >SB_26275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_25093| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_23631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_19329| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 88 DVPPQPNSQPGSVFDTDRS 106 >SB_18891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_17342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 88 DVPPQPNSQPGSVFDTDRS 106 >SB_16538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 88 DVPPQPNSQPGSVFDTDRS 106 >SB_14423| Best HMM Match : Attractin (HMM E-Value=7) Length = 162 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 139 DVPPQPNSQPGSVFDTDRS 157 >SB_11715| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_9762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_7799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_3610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_2425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.78 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VPPQ NS PGSV + D + Sbjct: 101 DVPPQPNSQPGSVFDTDRS 119 >SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) Length = 276 Score = 28.3 bits (60), Expect = 1.0 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPD 205 +VPPQ NS PGSV + D Sbjct: 88 DVPPQPNSQPGSVFDTD 104 >SB_9131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 1.0 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPD 205 +VPPQ NS PGSV + D Sbjct: 101 DVPPQPNSQPGSVFDTD 117 >SB_55897| Best HMM Match : RVT_1 (HMM E-Value=5.3e-37) Length = 732 Score = 27.9 bits (59), Expect = 1.4 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 20 ISGRSFRAIVAEKPLLSLFH 79 + GR F I KPLLSLFH Sbjct: 374 VFGRDFDIITDHKPLLSLFH 393 >SB_50942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 638 Score = 27.9 bits (59), Expect = 1.4 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -3 Query: 146 GTKHRAPADIIDRAPLPPNRV 84 GT HR PA+ R +P NRV Sbjct: 519 GTHHRVPAEATGRVDVPDNRV 539 >SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11) Length = 3037 Score = 27.9 bits (59), Expect = 1.4 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = -3 Query: 128 PADIIDRAPLPPNRVSNETMKVVVFQRRSRETI 30 PA + +++PLP N ++E +++ QRR E + Sbjct: 2409 PAKLPNQSPLPNNASASEIQRILENQRREEELL 2441 >SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1829 Score = 27.9 bits (59), Expect = 1.4 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 20 ISGRSFRAIVAEKPLLSLFH 79 + GR F I KPLLSLFH Sbjct: 1317 VFGRDFDIITDHKPLLSLFH 1336 >SB_27207| Best HMM Match : eIF-5a (HMM E-Value=3.1e-15) Length = 710 Score = 27.9 bits (59), Expect = 1.4 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 20 ISGRSFRAIVAEKPLLSLFH 79 + GR F I KPLLSLFH Sbjct: 79 VFGRDFDIITDHKPLLSLFH 98 >SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) Length = 1280 Score = 27.9 bits (59), Expect = 1.4 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 20 ISGRSFRAIVAEKPLLSLFH 79 + GR F I KPLLSLFH Sbjct: 608 VFGRDFDIITDHKPLLSLFH 627 >SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) Length = 250 Score = 27.9 bits (59), Expect = 1.4 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -3 Query: 146 GTKHRAPADIIDRAPLPPNRV 84 GT HR PA+ R +P NRV Sbjct: 225 GTHHRVPAEATGRVDVPDNRV 245 >SB_39271| Best HMM Match : Secretin_N (HMM E-Value=2.4) Length = 300 Score = 27.9 bits (59), Expect = 1.4 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 20 ISGRSFRAIVAEKPLLSLFH 79 + GR F I KPLLSLFH Sbjct: 259 VFGRDFDIITDHKPLLSLFH 278 >SB_35785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1089 Score = 27.9 bits (59), Expect = 1.4 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 20 ISGRSFRAIVAEKPLLSLFH 79 + GR F I KPLLSLFH Sbjct: 568 VFGRDFDIITDHKPLLSLFH 587 >SB_31551| Best HMM Match : RVT_1 (HMM E-Value=5.3e-37) Length = 429 Score = 27.9 bits (59), Expect = 1.4 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 20 ISGRSFRAIVAEKPLLSLFH 79 + GR F I KPLLSLFH Sbjct: 347 VFGRDFDIITDHKPLLSLFH 366 >SB_27585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 27.9 bits (59), Expect = 1.4 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 20 ISGRSFRAIVAEKPLLSLFH 79 + GR F I KPLLSLFH Sbjct: 167 VFGRDFDIITDHKPLLSLFH 186 >SB_18117| Best HMM Match : rve (HMM E-Value=1.7e-29) Length = 1544 Score = 27.9 bits (59), Expect = 1.4 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 20 ISGRSFRAIVAEKPLLSLFH 79 + GR F I KPLLSLFH Sbjct: 773 VFGRDFDIITDHKPLLSLFH 792 >SB_14634| Best HMM Match : ATP-synt_E (HMM E-Value=2.6) Length = 309 Score = 27.9 bits (59), Expect = 1.4 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 20 ISGRSFRAIVAEKPLLSLFH 79 + GR F I KPLLSLFH Sbjct: 167 VFGRDFDIITDHKPLLSLFH 186 >SB_12900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 27.9 bits (59), Expect = 1.4 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 20 ISGRSFRAIVAEKPLLSLFH 79 + GR F I KPLLSLFH Sbjct: 608 VFGRDFDIITDHKPLLSLFH 627 >SB_9508| Best HMM Match : Secretin_N (HMM E-Value=1.8) Length = 391 Score = 27.9 bits (59), Expect = 1.4 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 20 ISGRSFRAIVAEKPLLSLFH 79 + GR F I KPLLSLFH Sbjct: 241 VFGRDFDIITDHKPLLSLFH 260 >SB_30799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.5 bits (58), Expect = 1.8 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = -3 Query: 101 LPPNRVSNETMKVVVFQRR 45 LP +R+S +T++VVVF RR Sbjct: 67 LPLHRISKKTIRVVVFHRR 85 >SB_28307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 761 Score = 27.1 bits (57), Expect = 2.4 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = -3 Query: 173 SATSPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRR 45 S +SP T T+ P+D P P R++ E + + + RR Sbjct: 719 SVSSPAATSATEKPPPSDKRPETPARPKRITREPVYLKDYVRR 761 >SB_18330| Best HMM Match : rve (HMM E-Value=1.2e-16) Length = 997 Score = 27.1 bits (57), Expect = 2.4 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = -3 Query: 173 SATSPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRR 45 S +SP T T+ P+D P P R++ E + + + RR Sbjct: 955 SVSSPAATSATEKPPPSDKRPETPARPKRITREPVYLKDYVRR 997 >SB_51136| Best HMM Match : Lac_bphage_repr (HMM E-Value=2.1) Length = 240 Score = 26.6 bits (56), Expect = 3.1 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Frame = +3 Query: 66 FHCFITYSVGR-KRCAV--DNIGGRTVFRSKRAEW*RGGNARRRLKLPRDPVRGH 221 F+ + + VG K A+ D++ R +F RA+ R +RRL+LP GH Sbjct: 28 FNDILVFGVGESKEEAILNDDVRLRALFEKCRAKGFRLNKDKRRLRLPEVSFMGH 82 >SB_6210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 26.6 bits (56), Expect = 3.1 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 198 PRDPVRGHCQAGSLTGAVHCQ 260 P V+ HC A +T VHCQ Sbjct: 40 PMGQVKLHCTANGITRKVHCQ 60 >SB_35492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 26.2 bits (55), Expect = 4.2 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -2 Query: 255 NVPPQSNSPPGSVLE 211 +VPPQ NS PGSV + Sbjct: 101 DVPPQPNSQPGSVFD 115 >SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5222 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 155 CTLGTKHRAPADIIDRAPLPPNRVSNETMKV 63 CT G ++R P D I PP R + KV Sbjct: 176 CTSGARYRRPTDGITGDICPPGRYCEQGTKV 206 >SB_48283| Best HMM Match : ABC-3 (HMM E-Value=2.4) Length = 745 Score = 25.8 bits (54), Expect = 5.5 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = +3 Query: 171 GNARRRLKLPRDPVRGHCQAGSLTGAVHCQKK 266 G+ R K PRD G + G +HC K Sbjct: 117 GSLPARFKCPRDSCLGGLDSTCKEGCIHCPSK 148 >SB_58829| Best HMM Match : HC2 (HMM E-Value=5.8) Length = 959 Score = 25.4 bits (53), Expect = 7.3 Identities = 13/48 (27%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +2 Query: 110 GR*YRRAHGVSFQACRVVTWRKRSSPFKT---PA*SGSRTLPGGEFDW 244 G Y+R HG + + R + W KR + +G + L G +W Sbjct: 218 GNGYKRLHGANGEWIREIAWGKRGMDIRDCMGQTGNGYKRLHGANGEW 265 >SB_44281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 292 Score = 25.4 bits (53), Expect = 7.3 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = -3 Query: 119 IIDRAPLPPNRVSNETMKVVVFQRRSRETISHLCYTSHV 3 ++ R+ + RVS T +VVF RR ++S LCY + V Sbjct: 94 VVCRSGVLTCRVS--TYLLVVFSRRCEMSVSDLCYQALV 130 >SB_38920| Best HMM Match : Tetraspannin (HMM E-Value=3.5e-07) Length = 219 Score = 25.4 bits (53), Expect = 7.3 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = -1 Query: 214 RTGSRGSFKRRRAFPPRHHSARLERNTVRPPILSTAHRFRPTE*VM 77 R G++ R + RHH + R T+RP TA F E +M Sbjct: 151 RPGNKAPITRSQTPAVRHHLLGVARGTIRPTY--TARHFHYLEKLM 194 >SB_26839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 25.4 bits (53), Expect = 7.3 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = -2 Query: 237 NSPPGSVLEPDHAGVLNGDERFRHVTT--LHAW 145 NS P V+EPD + + RFR+V+ H W Sbjct: 263 NSFPDEVVEPDDVANPDHNSRFRYVSAKLSHFW 295 >SB_23790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 25.4 bits (53), Expect = 7.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -2 Query: 255 NVPPQSNSPPGSVLEPDHA 199 +VP Q NS PGSV + D + Sbjct: 101 DVPTQPNSQPGSVFDTDRS 119 >SB_9571| Best HMM Match : Plasmodium_HRP (HMM E-Value=6.2) Length = 225 Score = 25.4 bits (53), Expect = 7.3 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = -3 Query: 119 IIDRAPLPPNRVSNETMKVVVFQRRSRETISHLCYTSHV 3 ++ R+ + RVS T +VVF RR ++S LCY + V Sbjct: 27 VVCRSGVLTCRVS--TYLLVVFSRRCEMSVSDLCYQALV 63 >SB_33873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1362 Score = 25.4 bits (53), Expect = 7.3 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = -2 Query: 237 NSPPGSVLEPDHAGVLNGDERFRHVTT--LHAW 145 NS P V+EPD + + RFR+V+ H W Sbjct: 1205 NSFPDEVVEPDDVANPDHNSRFRYVSAKLSHFW 1237 >SB_28991| Best HMM Match : EGF_2 (HMM E-Value=2.9e-06) Length = 263 Score = 25.0 bits (52), Expect = 9.6 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -1 Query: 202 RGSFKRRRAFPPRHHSARLERNTVRPPILSTA 107 + S K +A P H A + RPP+ S A Sbjct: 151 KDSHKHHKAVKPHHKHAHAQAYAPRPPMYSDA 182 >SB_13793| Best HMM Match : Helicase_C (HMM E-Value=5.6) Length = 146 Score = 25.0 bits (52), Expect = 9.6 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +2 Query: 131 HGVSFQACRVVTWRKRSSPFKTPA*SGSRTLPGGE 235 +G F AC +VT + S P + R L GG+ Sbjct: 111 YGGRFNACELVTVERVPSGIAAPVWNRERNLSGGK 145 >SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 336 Score = 25.0 bits (52), Expect = 9.6 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -1 Query: 217 PRTGSRGSFKRRRAFPPRHHSARLERNTVRPP 122 PR G R +RRR+ P HH R+ R P Sbjct: 202 PRRGYRD--QRRRSHSPAHHRRSRSRSRSRSP 231 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 25.0 bits (52), Expect = 9.6 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -2 Query: 258 DNVPPQSNSPPGSVLEPDHAGVLNGDERF 172 +N PP + SV +PDHAG NG F Sbjct: 1392 ENQPPGQSVLKISVFDPDHAG--NGQVAF 1418 >SB_16796| Best HMM Match : Multi_Drug_Res (HMM E-Value=0.96) Length = 725 Score = 25.0 bits (52), Expect = 9.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 61 WFFSDDRAKRSPTYATPLMS 2 WF+S + RS TYA +MS Sbjct: 426 WFYSLTKETRSATYAPAIMS 445 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,380,911 Number of Sequences: 59808 Number of extensions: 183123 Number of successful extensions: 609 Number of sequences better than 10.0: 86 Number of HSP's better than 10.0 without gapping: 554 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 609 length of database: 16,821,457 effective HSP length: 65 effective length of database: 12,933,937 effective search space used: 297480551 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -