BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0668.Seq (929 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 25 1.1 U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 23 4.5 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 22 5.9 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 22 5.9 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 22 5.9 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 22 5.9 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 22 5.9 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 22 5.9 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 22 5.9 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 22 5.9 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 22 5.9 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 7.8 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 7.8 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 7.8 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 7.8 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 24.6 bits (51), Expect = 1.1 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +2 Query: 62 HPGVTLTFHLEQHHGTEHQRH 124 HPG+T +H H+ H H Sbjct: 158 HPGMTFRYHFNVHNSGTHFWH 178 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 22.6 bits (46), Expect = 4.5 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 539 KAPATHHLRGRSDHIPPSCRRPAPAI 616 K+P HLR R D PP + P + Sbjct: 208 KSPPEKHLRLRRDTAPPQWYQHQPLL 233 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 22.2 bits (45), Expect = 5.9 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 426 RRAGRHDGCGVLVSLRHFV*STVYSD 349 R A RHDG + +S+ V S+VY D Sbjct: 197 RNAFRHDGLLLTMSVLPNVNSSVYYD 222 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 5.9 Identities = 11/42 (26%), Positives = 17/42 (40%) Frame = +2 Query: 11 PACGQGTNQQPGRWYQRHPGVTLTFHLEQHHGTEHQRHPCQH 136 PA G G G + Q P + HL+ + H C++ Sbjct: 60 PAPGHGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKY 101 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 5.9 Identities = 11/42 (26%), Positives = 17/42 (40%) Frame = +2 Query: 11 PACGQGTNQQPGRWYQRHPGVTLTFHLEQHHGTEHQRHPCQH 136 PA G G G + Q P + HL+ + H C++ Sbjct: 60 PAPGHGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKY 101 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 22.2 bits (45), Expect = 5.9 Identities = 11/42 (26%), Positives = 17/42 (40%) Frame = +2 Query: 11 PACGQGTNQQPGRWYQRHPGVTLTFHLEQHHGTEHQRHPCQH 136 PA G G G + Q P + HL+ + H C++ Sbjct: 60 PAPGHGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKY 101 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 5.9 Identities = 11/42 (26%), Positives = 17/42 (40%) Frame = +2 Query: 11 PACGQGTNQQPGRWYQRHPGVTLTFHLEQHHGTEHQRHPCQH 136 PA G G G + Q P + HL+ + H C++ Sbjct: 60 PAPGHGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKY 101 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 22.2 bits (45), Expect = 5.9 Identities = 11/42 (26%), Positives = 17/42 (40%) Frame = +2 Query: 11 PACGQGTNQQPGRWYQRHPGVTLTFHLEQHHGTEHQRHPCQH 136 PA G G G + Q P + HL+ + H C++ Sbjct: 60 PAPGHGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKY 101 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 22.2 bits (45), Expect = 5.9 Identities = 11/42 (26%), Positives = 17/42 (40%) Frame = +2 Query: 11 PACGQGTNQQPGRWYQRHPGVTLTFHLEQHHGTEHQRHPCQH 136 PA G G G + Q P + HL+ + H C++ Sbjct: 16 PAPGHGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKY 57 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 22.2 bits (45), Expect = 5.9 Identities = 11/42 (26%), Positives = 17/42 (40%) Frame = +2 Query: 11 PACGQGTNQQPGRWYQRHPGVTLTFHLEQHHGTEHQRHPCQH 136 PA G G G + Q P + HL+ + H C++ Sbjct: 60 PAPGHGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKY 101 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 22.2 bits (45), Expect = 5.9 Identities = 11/42 (26%), Positives = 17/42 (40%) Frame = +2 Query: 11 PACGQGTNQQPGRWYQRHPGVTLTFHLEQHHGTEHQRHPCQH 136 PA G G G + Q P + HL+ + H C++ Sbjct: 60 PAPGHGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKY 101 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 7.8 Identities = 5/9 (55%), Positives = 7/9 (77%) Frame = -1 Query: 308 RICWAWCLL 282 R+ W WCL+ Sbjct: 128 RVAWMWCLI 136 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 7.8 Identities = 5/9 (55%), Positives = 7/9 (77%) Frame = -1 Query: 308 RICWAWCLL 282 R+ W WCL+ Sbjct: 128 RVAWMWCLI 136 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 7.8 Identities = 5/9 (55%), Positives = 7/9 (77%) Frame = -1 Query: 308 RICWAWCLL 282 R+ W WCL+ Sbjct: 128 RVAWMWCLI 136 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 7.8 Identities = 5/9 (55%), Positives = 7/9 (77%) Frame = -1 Query: 308 RICWAWCLL 282 R+ W WCL+ Sbjct: 128 RVAWMWCLI 136 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 222,547 Number of Sequences: 336 Number of extensions: 4852 Number of successful extensions: 21 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 26065116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -