BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0659.Seq (850 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 5e-19 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 88 7e-18 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 88 7e-18 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 88 7e-18 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 85 7e-17 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 8e-15 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 74 1e-13 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 74 1e-13 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 71 9e-13 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 71 9e-13 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 71 9e-13 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 71 9e-13 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 71 9e-13 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 71 9e-13 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 71 9e-13 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 71 9e-13 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 71 9e-13 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 71 9e-13 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 71 9e-13 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 71 9e-13 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 71 9e-13 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 71 9e-13 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 71 9e-13 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 71 9e-13 SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) 71 1e-12 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 71 1e-12 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 71 2e-12 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 2e-12 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 2e-12 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 71 2e-12 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 3e-12 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 3e-12 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 3e-12 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 3e-12 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 3e-12 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 69 4e-12 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 4e-12 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 4e-12 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 4e-12 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 4e-12 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 8e-12 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 8e-12 SB_25288| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 8e-12 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 68 8e-12 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 8e-12 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 68 8e-12 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 68 1e-11 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 68 1e-11 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 68 1e-11 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 68 1e-11 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 68 1e-11 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 68 1e-11 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 68 1e-11 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 68 1e-11 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 68 1e-11 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 68 1e-11 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 68 1e-11 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 68 1e-11 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 68 1e-11 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 68 1e-11 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 68 1e-11 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 68 1e-11 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 68 1e-11 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 68 1e-11 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 68 1e-11 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 68 1e-11 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 68 1e-11 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 68 1e-11 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 68 1e-11 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 68 1e-11 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 68 1e-11 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 68 1e-11 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 68 1e-11 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 68 1e-11 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 68 1e-11 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 68 1e-11 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 68 1e-11 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 68 1e-11 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 68 1e-11 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 68 1e-11 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 68 1e-11 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 68 1e-11 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) 68 1e-11 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 68 1e-11 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 68 1e-11 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 68 1e-11 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 68 1e-11 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) 68 1e-11 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 68 1e-11 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 68 1e-11 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 68 1e-11 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 68 1e-11 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 68 1e-11 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 68 1e-11 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 68 1e-11 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 68 1e-11 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 68 1e-11 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 68 1e-11 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 68 1e-11 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 68 1e-11 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 68 1e-11 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) 68 1e-11 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 68 1e-11 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 68 1e-11 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 68 1e-11 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 68 1e-11 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 68 1e-11 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 68 1e-11 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 68 1e-11 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 68 1e-11 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 68 1e-11 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 68 1e-11 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 68 1e-11 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 68 1e-11 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 68 1e-11 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 68 1e-11 SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) 68 1e-11 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 68 1e-11 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 68 1e-11 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 68 1e-11 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 68 1e-11 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 68 1e-11 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 68 1e-11 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 68 1e-11 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 68 1e-11 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 68 1e-11 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 68 1e-11 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 68 1e-11 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 68 1e-11 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 68 1e-11 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 68 1e-11 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 68 1e-11 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 68 1e-11 SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) 68 1e-11 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 68 1e-11 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 68 1e-11 SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 68 1e-11 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 68 1e-11 SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 68 1e-11 SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_33231| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_31481| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_31350| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 68 1e-11 SB_30835| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 68 1e-11 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 68 1e-11 SB_30218| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_29409| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_28808| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_26038| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_25742| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_25630| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3) 68 1e-11 SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 68 1e-11 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 68 1e-11 SB_23282| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_22993| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 92.3 bits (219), Expect = 5e-19 Identities = 43/59 (72%), Positives = 44/59 (74%) Frame = -3 Query: 563 QXRNCWEGRSVRASSLLRRWRKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 387 Q RNCWEGRSVRASSLLR+ KG GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 22 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 88.2 bits (209), Expect = 7e-18 Identities = 45/67 (67%), Positives = 48/67 (71%) Frame = -3 Query: 587 AYNLPFAIQXRNCWEGRSVRASSLLRRWRKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNT 408 A + PF + RNCWEGRSVRASSLLR+ KG GFPSHDVVKRRPVNCNT Sbjct: 587 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNT 641 Query: 407 THYRANW 387 THYRANW Sbjct: 642 THYRANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 88.2 bits (209), Expect = 7e-18 Identities = 45/67 (67%), Positives = 48/67 (71%) Frame = -3 Query: 587 AYNLPFAIQXRNCWEGRSVRASSLLRRWRKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNT 408 A + PF + RNCWEGRSVRASSLLR+ KG GFPSHDVVKRRPVNCNT Sbjct: 30 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNT 84 Query: 407 THYRANW 387 THYRANW Sbjct: 85 THYRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 88.2 bits (209), Expect = 7e-18 Identities = 45/67 (67%), Positives = 48/67 (71%) Frame = -3 Query: 587 AYNLPFAIQXRNCWEGRSVRASSLLRRWRKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNT 408 A + PF + RNCWEGRSVRASSLLR+ KG GFPSHDVVKRRPVNCNT Sbjct: 30 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNT 84 Query: 407 THYRANW 387 THYRANW Sbjct: 85 THYRANW 91 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 87.4 bits (207), Expect = 1e-17 Identities = 43/63 (68%), Positives = 46/63 (73%), Gaps = 1/63 (1%) Frame = +3 Query: 390 IRPIVSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAA**RRGPHRS-PFPTVAXLN 566 +RP+VSRITIHW SFYNVVTGKTLALPNLIALQHIPLSPA P + LN Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIPLSPAGVIAEEARTDRPSQQLRSLN 92 Query: 567 GEW 575 GEW Sbjct: 93 GEW 95 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 87.4 bits (207), Expect = 1e-17 Identities = 43/61 (70%), Positives = 45/61 (73%), Gaps = 1/61 (1%) Frame = +3 Query: 396 PIVSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAA**RRGPHRS-PFPTVAXLNGE 572 P +SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPA R P + LNGE Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGLHREEARTDRPSQQLRSLNGE 136 Query: 573 W 575 W Sbjct: 137 W 137 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 85.0 bits (201), Expect = 7e-17 Identities = 42/58 (72%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = +3 Query: 405 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAA**RRGPHRSPFP-TVAXLNGEW 575 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPA + P P + LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPKQLRSLNGEW 59 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 82.2 bits (194), Expect = 5e-16 Identities = 41/58 (70%), Positives = 42/58 (72%), Gaps = 1/58 (1%) Frame = +3 Query: 405 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAA**RRGPHRS-PFPTVAXLNGEW 575 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPA P + LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVNSEEARTDRPSQQLRSLNGEW 59 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 78.2 bits (184), Expect = 8e-15 Identities = 38/55 (69%), Positives = 43/55 (78%), Gaps = 3/55 (5%) Frame = -3 Query: 542 GRSVRAS--SLLRRWRKGDVLQGD*-VG*RQGFPSHDVVKRRPVNCNTTHYRANW 387 GR++ A ++ KGDVLQGD +G RQGFPSHDVVKRRPVNCNTTHYRANW Sbjct: 48 GRAIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -2 Query: 558 AQLLGRAIGAGLFAITPLAKGG 493 AQLLGRAIGAGLFAITP + G Sbjct: 44 AQLLGRAIGAGLFAITPAGEKG 65 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 74.9 bits (176), Expect = 7e-14 Identities = 36/56 (64%), Positives = 40/56 (71%), Gaps = 1/56 (1%) Frame = +3 Query: 420 HWPSFYNVVTGKTLALPNLIALQHIPLSPAA**RRGPHRS-PFPTVAXLNGEWQIV 584 HWPSFYNVVTGKTLALPNLIALQHIPLSPA P + LNGEW+++ Sbjct: 5 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGRNSEEARTDRPSQQLRSLNGEWRLM 60 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 74.1 bits (174), Expect = 1e-13 Identities = 40/60 (66%), Positives = 41/60 (68%), Gaps = 3/60 (5%) Frame = +3 Query: 405 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAA**RRGPHR---SPFPTVAXLNGEW 575 SRITIHWPSFYNVVTGKTLALPNLIALQHIP P A R P + LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIP--PFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) Length = 82 Score = 74.1 bits (174), Expect = 1e-13 Identities = 43/80 (53%), Positives = 45/80 (56%), Gaps = 3/80 (3%) Frame = +2 Query: 344 RDNHGSRRNWGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFAS---GV 514 R H SRR GG V LAVVLQRRDWENPGVTQLNRLAAHPPFAS Sbjct: 2 RKRHASRREKGGQVSESTCRHASLA-LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 60 Query: 515 IAKRPAPIALPNSCAXEWRM 574 A+ P S EWR+ Sbjct: 61 EARTDRPSQQLRSLNGEWRL 80 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 74.1 bits (174), Expect = 1e-13 Identities = 38/66 (57%), Positives = 43/66 (65%), Gaps = 3/66 (4%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRMANCKR* 592 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ C + Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRCGQN 112 Query: 593 YFXKIR 610 Y ++R Sbjct: 113 YTTRLR 118 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 72.1 bits (169), Expect = 5e-13 Identities = 43/83 (51%), Positives = 45/83 (54%), Gaps = 6/83 (7%) Frame = +2 Query: 344 RDNHGSRRNWGGPVXXXXXXXXXXXX---LAVVLQRRDWENPGVTQLNRLAAHPPFAS-- 508 R H SRR GG V LAVVLQRRDWENPGVTQLNRLAAHPPFAS Sbjct: 2 RKRHASRREKGGQVSGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWR 61 Query: 509 -GVIAKRPAPIALPNSCAXEWRM 574 A+ P S EWR+ Sbjct: 62 NSEEARTDRPSQQLRSLNGEWRL 84 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 72.1 bits (169), Expect = 5e-13 Identities = 43/83 (51%), Positives = 45/83 (54%), Gaps = 6/83 (7%) Frame = +2 Query: 344 RDNHGSRRNWGGPVXXXXXXXXXXXX---LAVVLQRRDWENPGVTQLNRLAAHPPFAS-- 508 R H SRR GG V LAVVLQRRDWENPGVTQLNRLAAHPPFAS Sbjct: 2 RKRHASRREKGGQVSGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWR 61 Query: 509 -GVIAKRPAPIALPNSCAXEWRM 574 A+ P S EWR+ Sbjct: 62 NSEEARTDRPSQQLRSLNGEWRL 84 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -3 Query: 587 AYNLPFAIQXRNCWEGRSVRASSLLRRWRKG 495 A + PF + RNCWEGRSVRASSLLR+ KG Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 30 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 227 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 269 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -3 Query: 587 AYNLPFAIQXRNCWEGRSVRASSLLRRWRKG 495 A + PF + RNCWEGRSVRASSLLR+ KG Sbjct: 214 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 242 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 895 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 937 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -3 Query: 563 QXRNCWEGRSVRASSLLRRWRKG 495 Q RNCWEGRSVRASSLLR+ KG Sbjct: 888 QLRNCWEGRSVRASSLLRQLAKG 910 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 7 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 49 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -3 Query: 548 WEGRSVRASSLLRRWRKG 495 WEGRSVRASSLLR+ KG Sbjct: 5 WEGRSVRASSLLRQLAKG 22 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 382 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 424 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -3 Query: 587 AYNLPFAIQXRNCWEGRSVRASSLLRRWRKG 495 A + PF + RNCWEGRSVRASSLLR+ KG Sbjct: 369 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 397 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 9e-13 Identities = 43/84 (51%), Positives = 45/84 (53%), Gaps = 7/84 (8%) Frame = +2 Query: 344 RDNHGSRRNWGGPVXXXXXXXXXXXX----LAVVLQRRDWENPGVTQLNRLAAHPPFAS- 508 R H SRR GG V LAVVLQRRDWENPGVTQLNRLAAHPPFAS Sbjct: 2 RKRHASRREKGGQVSAGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 61 Query: 509 --GVIAKRPAPIALPNSCAXEWRM 574 A+ P S EWR+ Sbjct: 62 RNSEEARTDRPSQQLRSLNGEWRL 85 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 231 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 273 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 226 RNCWEGRSVRASSLLRQLAKG 246 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 298 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 340 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -3 Query: 587 AYNLPFAIQXRNCWEGRSVRASSLLRRWRKG 495 A + PF + RNCWEGRSVRASSLLR+ KG Sbjct: 285 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 313 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 364 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 406 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 359 RNCWEGRSVRASSLLRQLAKG 379 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 71.3 bits (167), Expect = 9e-13 Identities = 36/59 (61%), Positives = 39/59 (66%), Gaps = 3/59 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRMANCKR 589 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ C + Sbjct: 170 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRCDK 228 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 56 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 98 Score = 39.1 bits (87), Expect = 0.004 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = -3 Query: 599 QNINAYNLPFAIQXRNCWEGRSVRASSLLRRWRKG 495 +N A + PF + RNC EGRSVRASSLLR+ KG Sbjct: 39 KNQGASHSPFRL--RNCGEGRSVRASSLLRQLAKG 71 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 71.3 bits (167), Expect = 9e-13 Identities = 41/79 (51%), Positives = 46/79 (58%), Gaps = 3/79 (3%) Frame = +2 Query: 347 DNHGSRRNWGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVI 517 D+H S R+ G P+ LAVVLQRRDWENPGVTQLNRLAAHPPFAS Sbjct: 162 DHHLSHRSHGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 219 Query: 518 AKRPAPIALPNSCAXEWRM 574 A+ P S EWR+ Sbjct: 220 ARTDRPSQQLRSLNGEWRL 238 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -3 Query: 587 AYNLPFAIQXRNCWEGRSVRASSLLRRWRKG 495 A + PF + RNCWEGRSVRASSLLR+ KG Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 30 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -3 Query: 587 AYNLPFAIQXRNCWEGRSVRASSLLRRWRKG 495 A + PF + RNCWEGRSVRASSLLR+ KG Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 30 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -3 Query: 587 AYNLPFAIQXRNCWEGRSVRASSLLRRWRKG 495 A + PF + RNCWEGRSVRASSLLR+ KG Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 30 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 38 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 80 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -3 Query: 587 AYNLPFAIQXRNCWEGRSVRASSLLRRWRKG 495 A + PF + RNCWEGRSVRASSLLR+ KG Sbjct: 25 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 53 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 274 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 316 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 269 RNCWEGRSVRASSLLRQLAKG 289 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 258 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 300 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 253 RNCWEGRSVRASSLLRQLAKG 273 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 247 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 289 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = -3 Query: 566 IQXRNCWEGRSVRASSLLRRWRKG 495 I+ RNCWEGRSVRASSLLR+ KG Sbjct: 239 IRLRNCWEGRSVRASSLLRQLAKG 262 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 272 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 314 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -3 Query: 587 AYNLPFAIQXRNCWEGRSVRASSLLRRWRKG 495 A + PF + RNCWEGRSVRASSLLR+ KG Sbjct: 259 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 287 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 456 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 498 Score = 45.6 bits (103), Expect = 5e-05 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = -3 Query: 596 NINAYNLPFAIQXRNCWEGRSVRASSLLRRWRKG 495 N+ A + PF + RNCWEGRSVRASSLLR+ KG Sbjct: 440 NMGASHSPFRL--RNCWEGRSVRASSLLRQLAKG 471 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 125 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 167 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 120 RNCWEGRSVRASSLLRQLAKG 140 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 291 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -3 Query: 587 AYNLPFAIQXRNCWEGRSVRASSLLRRWRKG 495 A + PF + RNCWEGRSVRASSLLR+ KG Sbjct: 278 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 306 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 141 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 183 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -3 Query: 587 AYNLPFAIQXRNCWEGRSVRASSLLRRWRKG 495 A + PF + RNCWEGRSVRASSLLR+ KG Sbjct: 128 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 156 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -3 Query: 587 AYNLPFAIQXRNCWEGRSVRASSLLRRWRKG 495 A + PF + RNCWEGRSVRASSLLR+ KG Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 30 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -3 Query: 587 AYNLPFAIQXRNCWEGRSVRASSLLRRWRKG 495 A + PF + RNCWEGRSVRASSLLR+ KG Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 30 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 200 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 242 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 195 RNCWEGRSVRASSLLRQLAKG 215 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 592 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 634 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -3 Query: 587 AYNLPFAIQXRNCWEGRSVRASSLLRRWRKG 495 A + PF + RNCWEGRSVRASSLLR+ KG Sbjct: 579 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 607 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 228 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 270 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/39 (51%), Positives = 25/39 (64%) Frame = -3 Query: 611 REFXQNINAYNLPFAIQXRNCWEGRSVRASSLLRRWRKG 495 + F N + + + RNCWEGRSVRASSLLR+ KG Sbjct: 205 KRFQGNSQSSKYCISAKLRNCWEGRSVRASSLLRQLAKG 243 >SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) Length = 567 Score = 71.3 bits (167), Expect = 9e-13 Identities = 41/80 (51%), Positives = 44/80 (55%), Gaps = 3/80 (3%) Frame = +2 Query: 359 SRRNWGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRP 529 S NWGG LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ Sbjct: 178 SHLNWGGD-PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTD 236 Query: 530 APIALPNSCAXEWRMANCKR 589 P S EWR+ +R Sbjct: 237 RPSQQLRSLNGEWRLMRPQR 256 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 506 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 548 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -3 Query: 587 AYNLPFAIQXRNCWEGRSVRASSLLRRWRKG 495 A + PF + RNCWEGRSVRASSLLR+ KG Sbjct: 493 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 521 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 89 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 131 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/29 (68%), Positives = 23/29 (79%), Gaps = 1/29 (3%) Frame = -3 Query: 578 LPFAIQX-RNCWEGRSVRASSLLRRWRKG 495 +P A+ RNCWEGRSVRASSLLR+ KG Sbjct: 76 MPEAVSGLRNCWEGRSVRASSLLRQLAKG 104 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 397 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 439 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 392 RNCWEGRSVRASSLLRQLAKG 412 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 71.3 bits (167), Expect = 9e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 190 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/33 (63%), Positives = 25/33 (75%) Frame = -3 Query: 593 INAYNLPFAIQXRNCWEGRSVRASSLLRRWRKG 495 + A + PF + RNCWEGRSVRASSLLR+ KG Sbjct: 175 VGASHSPFRL--RNCWEGRSVRASSLLRQLAKG 205 >SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) Length = 1036 Score = 70.9 bits (166), Expect = 1e-12 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFASGVIAKRPAPIALPNSC 556 LAVVLQRRDWENPGVTQLNRLAAHPPFAS + P + L SC Sbjct: 142 LAVVLQRRDWENPGVTQLNRLAAHPPFASWLENLSPLTVNLTGSC 186 >SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) Length = 132 Score = 70.9 bits (166), Expect = 1e-12 Identities = 37/59 (62%), Positives = 39/59 (66%), Gaps = 3/59 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRMANCKR 589 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ KR Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRTKR 109 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 70.5 bits (165), Expect = 2e-12 Identities = 32/47 (68%), Positives = 34/47 (72%) Frame = +2 Query: 434 LQRRDWENPGVTQLNRLAAHPPFASGVIAKRPAPIALPNSCAXEWRM 574 LQRRDWENPGVTQLNRLAAHPPFAS ++RP P EWRM Sbjct: 348 LQRRDWENPGVTQLNRLAAHPPFASWRNSERPHRSPFPTVAQPEWRM 394 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 70.5 bits (165), Expect = 2e-12 Identities = 35/49 (71%), Positives = 38/49 (77%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL*YDSL 400 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASE D L Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEFPGDPL 62 Score = 65.7 bits (153), Expect = 4e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS 508 LAVVLQRRDWENPGVTQLNRLAAHPPFAS Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFAS 113 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -3 Query: 587 AYNLPFAIQXRNCWEGRSVRASSLLRRWRKG 495 A + PF + RNCWEGRSVRASSLLR+ KG Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 30 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = +1 Query: 496 PFRQRRNSEEARTDRPSQQLR 558 PF RNSEEARTDRPSQQLR Sbjct: 110 PFASWRNSEEARTDRPSQQLR 130 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 70.5 bits (165), Expect = 2e-12 Identities = 39/54 (72%), Positives = 43/54 (79%), Gaps = 1/54 (1%) Frame = -2 Query: 579 FAIRHSXAQLL-GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 FAI+ AQLL GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 12 FAIQ--AAQLLEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/30 (63%), Positives = 21/30 (70%) Frame = -3 Query: 584 YNLPFAIQXRNCWEGRSVRASSLLRRWRKG 495 + PFAIQ EGRSVRASSLLR+ KG Sbjct: 8 HQAPFAIQAAQLLEGRSVRASSLLRQLAKG 37 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 70.5 bits (165), Expect = 2e-12 Identities = 37/62 (59%), Positives = 40/62 (64%), Gaps = 3/62 (4%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRMANCKR* 592 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ R Sbjct: 191 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYMRD 250 Query: 593 YF 598 Y+ Sbjct: 251 YY 252 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 69.7 bits (163), Expect = 3e-12 Identities = 43/86 (50%), Positives = 45/86 (52%), Gaps = 9/86 (10%) Frame = +2 Query: 344 RDNHGSRRNWGGPVXXXXXXXXXXXX------LAVVLQRRDWENPGVTQLNRLAAHPPFA 505 R H SRR GG V LAVVLQRRDWENPGVTQLNRLAAHPPFA Sbjct: 2 RKRHASRREKGGQVSGVTGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA 61 Query: 506 S---GVIAKRPAPIALPNSCAXEWRM 574 S A+ P S EWR+ Sbjct: 62 SWRNSEEARTDRPSQQLRSLNGEWRL 87 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 69.7 bits (163), Expect = 3e-12 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASE 418 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 537 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 578 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/38 (52%), Positives = 28/38 (73%) Frame = -3 Query: 608 EFXQNINAYNLPFAIQXRNCWEGRSVRASSLLRRWRKG 495 E ++++ + P+ + RNCWEGRSVRASSLLR+ KG Sbjct: 515 EGHESVSRNSTPYTQRLRNCWEGRSVRASSLLRQLAKG 552 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 69.7 bits (163), Expect = 3e-12 Identities = 35/58 (60%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = +3 Query: 405 SRITIHWPSFYNVVTGKTLALPNLIALQHIPL-SPAA**RRGPHRSPFPTVAXLNGEW 575 SRITIHWPSFYNVVTGKTLALPNL L+HIPL + P + LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLFDLRHIPLYASCTTSEEARTDRPSQQLRSLNGEW 59 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 69.7 bits (163), Expect = 3e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 507 LAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 13 LAKGGCAARRLSWVTPGFSQSRRCKTTASEL 43 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 69.7 bits (163), Expect = 3e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 507 LAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 LAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 13 LAKGGCAARRLSWVTPGFSQSRRCKTTASEL 43 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 69.3 bits (162), Expect = 4e-12 Identities = 40/81 (49%), Positives = 44/81 (54%), Gaps = 3/81 (3%) Frame = +2 Query: 341 TRDNHGSRRNWGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFAS---G 511 T+ G RR+ G LAVVLQRRDWENPGVTQLNRLAAHPPFAS Sbjct: 1163 TKYKAGKRRSQGKGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 1222 Query: 512 VIAKRPAPIALPNSCAXEWRM 574 A+ P S EWR+ Sbjct: 1223 EEARTDRPSQQLRSLNGEWRL 1243 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -3 Query: 587 AYNLPFAIQXRNCWEGRSVRASSLLRRWRKG 495 A + PF + RNCWEGRSVRASSLLR+ KG Sbjct: 402 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 430 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSW 469 GR++ A + LAKGGCAARRLSW Sbjct: 415 GRSVRASSL-LRQLAKGGCAARRLSW 439 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 69.3 bits (162), Expect = 4e-12 Identities = 49/96 (51%), Positives = 58/96 (60%), Gaps = 6/96 (6%) Frame = -2 Query: 579 FAIRHSXAQLL-GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASE----L 415 FAI+ AQL GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS L Sbjct: 12 FAIQ--AAQLWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACL 68 Query: 414 *YDSL*GELGTGPPQ-FLRLPWLSRVTGNQGSIPER 310 DS G F + WL ++ N+ SIP + Sbjct: 69 QVDSRGSPGGKFEVAIFGLILWLVDISANETSIPAK 104 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = -3 Query: 584 YNLPFAIQXRNCWEGRSVRASSLLRRWRKG 495 + PFAIQ WEGRSVRASSLLR+ KG Sbjct: 8 HQAPFAIQAAQLWEGRSVRASSLLRQLAKG 37 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 69.3 bits (162), Expect = 4e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 420 HWPSFYNVVTGKTLALPNLIALQHIPLSPA 509 HWPSFYNVVTGKTLALPNLIALQHIPLSPA Sbjct: 62 HWPSFYNVVTGKTLALPNLIALQHIPLSPA 91 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/24 (79%), Positives = 21/24 (87%), Gaps = 1/24 (4%) Frame = +2 Query: 491 HPPFA-SGVIAKRPAPIALPNSCA 559 H P + +GVIAKRPAPIALPNSCA Sbjct: 85 HIPLSPAGVIAKRPAPIALPNSCA 108 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 69.3 bits (162), Expect = 4e-12 Identities = 36/58 (62%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = +3 Query: 405 SRITIHWPSFYNVVTGKTLALPNLIALQ-HIPLSPAA**RRGPHRSPFPTVAXLNGEW 575 SRITIHWPSFYNVVTGKTLALPNLIALQ H P + P + LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPFASWRNSEEARTDRPSQRLRSLNGEW 59 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 69.3 bits (162), Expect = 4e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 420 HWPSFYNVVTGKTLALPNLIALQHIPLSPA 509 HWPSFYNVVTGKTLALPNLIALQHIPLSPA Sbjct: 57 HWPSFYNVVTGKTLALPNLIALQHIPLSPA 86 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/24 (79%), Positives = 21/24 (87%), Gaps = 1/24 (4%) Frame = +2 Query: 491 HPPFA-SGVIAKRPAPIALPNSCA 559 H P + +GVIAKRPAPIALPNSCA Sbjct: 80 HIPLSPAGVIAKRPAPIALPNSCA 103 >SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 68.9 bits (161), Expect = 5e-12 Identities = 43/87 (49%), Positives = 45/87 (51%), Gaps = 10/87 (11%) Frame = +2 Query: 344 RDNHGSRRNWGGPVXXXXXXXXXXXX-------LAVVLQRRDWENPGVTQLNRLAAHPPF 502 R H SRR GG V LAVVLQRRDWENPGVTQLNRLAAHPPF Sbjct: 2 RKRHASRREKGGQVSVIPDGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 61 Query: 503 AS---GVIAKRPAPIALPNSCAXEWRM 574 AS A+ P S EWR+ Sbjct: 62 ASWRNSEEARTDRPSQQLRSLNGEWRL 88 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 8e-12 Identities = 38/71 (53%), Positives = 41/71 (57%), Gaps = 3/71 (4%) Frame = +2 Query: 371 WGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIA 541 WG P+ LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P Sbjct: 24 WGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQ 81 Query: 542 LPNSCAXEWRM 574 S EWR+ Sbjct: 82 QLRSLNGEWRL 92 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 68.1 bits (159), Expect = 8e-12 Identities = 38/54 (70%), Positives = 42/54 (77%), Gaps = 1/54 (1%) Frame = -2 Query: 579 FAIRHSXAQLL-GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 FAI+ AQL GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 12 FAIQ--AAQLWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = -3 Query: 584 YNLPFAIQXRNCWEGRSVRASSLLRRWRKG 495 + PFAIQ WEGRSVRASSLLR+ KG Sbjct: 8 HQAPFAIQAAQLWEGRSVRASSLLRQLAKG 37 >SB_25288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 68.1 bits (159), Expect = 8e-12 Identities = 35/56 (62%), Positives = 36/56 (64%) Frame = -2 Query: 588 RLQFAIRHSXAQLLGRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 RLQ A LLGRAIGAGLF ITP + G ARRLSWV P FSQS RC AS Sbjct: 2 RLQAPFAIQAAHLLGRAIGAGLFDITPACERGMCARRLSWVMPAFSQSSRCIMAAS 57 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 68.1 bits (159), Expect = 8e-12 Identities = 38/71 (53%), Positives = 41/71 (57%), Gaps = 3/71 (4%) Frame = +2 Query: 371 WGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIA 541 WG P+ LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P Sbjct: 66 WGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQ 123 Query: 542 LPNSCAXEWRM 574 S EWR+ Sbjct: 124 QLRSLNGEWRL 134 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 68.1 bits (159), Expect = 8e-12 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 507 LAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 346 LVKGGCAARRLSWVTPGFSQSRRCKTTASEL 376 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 68.1 bits (159), Expect = 8e-12 Identities = 35/58 (60%), Positives = 38/58 (65%), Gaps = 3/58 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRMANCK 586 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ + Sbjct: 529 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRAR 586 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 483 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 523 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = -3 Query: 575 PFAIQXRNCWEGRSVRASSLLRRWRKG 495 PF + RNCWEGRSVRASSLLR+ KG Sbjct: 474 PFRL--RNCWEGRSVRASSLLRQLAKG 498 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 62 [lacZ-alpha fragment, 54 aa] 115 >SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = -3 Query: 575 PFAIQXRNCWEGRSVRASSLLRRWRKG 495 PF + RNCWEGRSVRASSLLR+ KG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) Length = 212 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 153 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 193 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 148 RNCWEGRSVRASSLLRQLAKG 168 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 25 [lacZ-alpha fragment, 54 aa] 78 >SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 49 [lacZ-alpha fragment, 54 aa] 102 >SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 28 [lacZ-alpha fragment, 54 aa] 81 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 29 [lacZ-alpha fragment, 54 aa] 82 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 18 [lacZ-alpha fragment, 54 aa] 71 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 833 [lacZ-alpha fragment, 54 aa] 886 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 230 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 270 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 225 RNCWEGRSVRASSLLRQLAKG 245 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 114 [lacZ-alpha fragment, 54 aa] 167 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 374 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 414 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 369 RNCWEGRSVRASSLLRQLAKG 389 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 20 [lacZ-alpha fragment, 54 aa] 73 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 11 [lacZ-alpha fragment, 54 aa] 64 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 19 [lacZ-alpha fragment, 54 aa] 72 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = -3 Query: 575 PFAIQXRNCWEGRSVRASSLLRRWRKG 495 PF + RNCWEGRSVRASSLLR+ KG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 88 [lacZ-alpha fragment, 54 aa] 141 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 37 [lacZ-alpha fragment, 54 aa] 90 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 76 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 116 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = -3 Query: 575 PFAIQXRNCWEGRSVRASSLLRRWRKG 495 PF + RNCWEGRSVRASSLLR+ KG Sbjct: 67 PFRL--RNCWEGRSVRASSLLRQLAKG 91 >SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 132 [lacZ-alpha fragment, 54 aa] 185 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 22 [lacZ-alpha fragment, 54 aa] 75 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 153 [lacZ-alpha fragment, 54 aa] 206 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = -3 Query: 575 PFAIQXRNCWEGRSVRASSLLRRWRKG 495 PF + RNCWEGRSVRASSLLR+ KG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 57 [lacZ-alpha fragment, 54 aa] 110 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 21 [lacZ-alpha fragment, 54 aa] 74 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 657 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 697 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = -3 Query: 575 PFAIQXRNCWEGRSVRASSLLRRWRKG 495 PF + RNCWEGRSVRASSLLR+ KG Sbjct: 648 PFRL--RNCWEGRSVRASSLLRQLAKG 672 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 60 [lacZ-alpha fragment, 54 aa] 113 >SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 213 [lacZ-alpha fragment, 54 aa] 266 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 33 [lacZ-alpha fragment, 54 aa] 86 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 48 [lacZ-alpha fragment, 54 aa] 101 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 40 [lacZ-alpha fragment, 54 aa] 93 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 75 [lacZ-alpha fragment, 54 aa] 128 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = -3 Query: 575 PFAIQXRNCWEGRSVRASSLLRRWRKG 495 PF + RNCWEGRSVRASSLLR+ KG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 22 [lacZ-alpha fragment, 54 aa] 75 >SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 57 [lacZ-alpha fragment, 54 aa] 110 >SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 100 [lacZ-alpha fragment, 54 aa] 153 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 73 [lacZ-alpha fragment, 54 aa] 126 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 28 [lacZ-alpha fragment, 54 aa] 81 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 146 [lacZ-alpha fragment, 54 aa] 199 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 59 [lacZ-alpha fragment, 54 aa] 112 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 88 [lacZ-alpha fragment, 54 aa] 141 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 100 [lacZ-alpha fragment, 54 aa] 153 >SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 125 [lacZ-alpha fragment, 54 aa] 178 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 77 [lacZ-alpha fragment, 54 aa] 130 >SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) Length = 388 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) Length = 305 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 36 [lacZ-alpha fragment, 54 aa] 89 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 96 [lacZ-alpha fragment, 54 aa] 149 >SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 61 [lacZ-alpha fragment, 54 aa] 114 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 84 [lacZ-alpha fragment, 54 aa] 137 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 40 [lacZ-alpha fragment, 54 aa] 93 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 84 [lacZ-alpha fragment, 54 aa] 137 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 84 [lacZ-alpha fragment, 54 aa] 137 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 21 [lacZ-alpha fragment, 54 aa] 74 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 65 [lacZ-alpha fragment, 54 aa] 118 >SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 24 [lacZ-alpha fragment, 54 aa] 77 >SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) Length = 154 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 108 [lacZ-alpha fragment, 54 aa] 161 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 24 [lacZ-alpha fragment, 54 aa] 77 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 43 [lacZ-alpha fragment, 54 aa] 96 >SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 415 GR++ A + LAKGGCAARRLSWVTP FSQSRRCKTTASEL Sbjct: 7 GRSVRASSL-LRQLAKGGCAARRLSWVTPVFSQSRRCKTTASEL 49 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -3 Query: 548 WEGRSVRASSLLRRWRKG 495 WEGRSVRASSLLR+ KG Sbjct: 5 WEGRSVRASSLLRQLAKG 22 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 76 [lacZ-alpha fragment, 54 aa] 129 >SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = -3 Query: 575 PFAIQXRNCWEGRSVRASSLLRRWRKG 495 PF + RNCWEGRSVRASSLLR+ KG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 566 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 606 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = -3 Query: 575 PFAIQXRNCWEGRSVRASSLLRRWRKG 495 PF + RNCWEGRSVRASSLLR+ KG Sbjct: 557 PFRL--RNCWEGRSVRASSLLRQLAKG 581 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 67 [lacZ-alpha fragment, 54 aa] 120 >SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 91 [lacZ-alpha fragment, 54 aa] 144 >SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) Length = 666 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 413 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 453 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 408 RNCWEGRSVRASSLLRQLAKG 428 >SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 41 [lacZ-alpha fragment, 54 aa] 94 >SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 1063 [lacZ-alpha fragment, 54 aa] 1116 >SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) Length = 128 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) Length = 794 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 17 [lacZ-alpha fragment, 54 aa] 70 >SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = -3 Query: 575 PFAIQXRNCWEGRSVRASSLLRRWRKG 495 PF + RNCWEGRSVRASSLLR+ KG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = -3 Query: 575 PFAIQXRNCWEGRSVRASSLLRRWRKG 495 PF + RNCWEGRSVRASSLLR+ KG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 134 [lacZ-alpha fragment, 54 aa] 187 >SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 40 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 80 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 35 RNCWEGRSVRASSLLRQLAKG 55 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 182 [lacZ-alpha fragment, 54 aa] 235 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 59 [lacZ-alpha fragment, 54 aa] 112 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 19 [lacZ-alpha fragment, 54 aa] 72 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 146 [lacZ-alpha fragment, 54 aa] 199 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 58 [lacZ-alpha fragment, 54 aa] 111 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 796 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 836 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 791 RNCWEGRSVRASSLLRQLAKG 811 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = -3 Query: 575 PFAIQXRNCWEGRSVRASSLLRRWRKG 495 PF + RNCWEGRSVRASSLLR+ KG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 116 [lacZ-alpha fragment, 54 aa] 169 >SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) Length = 631 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 457 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 497 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 452 RNCWEGRSVRASSLLRQLAKG 472 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 23 [lacZ-alpha fragment, 54 aa] 76 >SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 652 [lacZ-alpha fragment, 54 aa] 705 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = -3 Query: 575 PFAIQXRNCWEGRSVRASSLLRRWRKG 495 PF + RNCWEGRSVRASSLLR+ KG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 39 [lacZ-alpha fragment, 54 aa] 92 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 161 [lacZ-alpha fragment, 54 aa] 214 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = -3 Query: 575 PFAIQXRNCWEGRSVRASSLLRRWRKG 495 PF + RNCWEGRSVRASSLLR+ KG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 47 [lacZ-alpha fragment, 54 aa] 100 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 32 [lacZ-alpha fragment, 54 aa] 85 >SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 76 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 116 Score = 37.9 bits (84), Expect = 0.010 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -3 Query: 575 PFAIQXRNCWEGRSVRASSLLRRWRKG 495 PF + RN WEGRSVRASSLLR+ KG Sbjct: 67 PFRL--RNYWEGRSVRASSLLRQLAKG 91 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 22 [lacZ-alpha fragment, 54 aa] 75 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 58 [lacZ-alpha fragment, 54 aa] 111 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 70 [lacZ-alpha fragment, 54 aa] 123 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 17 [lacZ-alpha fragment, 54 aa] 70 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 60 [lacZ-alpha fragment, 54 aa] 113 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = +1 Query: 496 PFRQRRNSEEARTDRPSQQLR 558 PF RNSEEARTDRPSQQLR Sbjct: 20 PFASWRNSEEARTDRPSQQLR 40 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 71 [lacZ-alpha fragment, 54 aa] 124 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 79 [lacZ-alpha fragment, 54 aa] 132 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = -3 Query: 575 PFAIQXRNCWEGRSVRASSLLRRWRKG 495 PF + RNCWEGRSVRASSLLR+ KG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 444 [lacZ-alpha fragment, 54 aa] 497 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 73 [lacZ-alpha fragment, 54 aa] 126 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 266 [lacZ-alpha fragment, 54 aa] 319 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 20 [lacZ-alpha fragment, 54 aa] 73 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 34 [lacZ-alpha fragment, 54 aa] 87 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 61 [lacZ-alpha fragment, 54 aa] 114 >SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 70 [lacZ-alpha fragment, 54 aa] 123 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 104 [lacZ-alpha fragment, 54 aa] 157 >SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) Length = 214 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 63 [lacZ-alpha fragment, 54 aa] 116 >SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 73 [lacZ-alpha fragment, 54 aa] 126 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 73 [lacZ-alpha fragment, 54 aa] 126 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 17 [lacZ-alpha fragment, 54 aa] 70 >SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 378 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 418 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 373 RNCWEGRSVRASSLLRQLAKG 393 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 74 [lacZ-alpha fragment, 54 aa] 127 >SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 1112 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 1152 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 1107 RNCWEGRSVRASSLLRQLAKG 1127 >SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) Length = 412 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 303 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 343 Score = 42.3 bits (95), Expect = 5e-04 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = -3 Query: 566 IQXRNCWEGRSVRASSLLRRWRKG 495 I RNCWEGRSVRASSLLR+ KG Sbjct: 295 ILLRNCWEGRSVRASSLLRQLAKG 318 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 83 [lacZ-alpha fragment, 54 aa] 136 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 117 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 157 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 112 RNCWEGRSVRASSLLRQLAKG 132 >SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 27 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 22 RNCWEGRSVRASSLLRQLAKG 42 >SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 176 [lacZ-alpha fragment, 54 aa] 229 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 31 [lacZ-alpha fragment, 54 aa] 84 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 83 [lacZ-alpha fragment, 54 aa] 136 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 20 [lacZ-alpha fragment, 54 aa] 73 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 49 [lacZ-alpha fragment, 54 aa] 102 >SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) Length = 466 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 73 [lacZ-alpha fragment, 54 aa] 126 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 142 [lacZ-alpha fragment, 54 aa] 195 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLAAHPPFAS---GVIAKRPAPIALPNSCAXEWRM 574 LAVVLQRRDWENPGVTQLNRLAAHPPFAS A+ P S EWR+ Sbjct: 68 [lacZ-alpha fragment, 54 aa] 121 >SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 546 GRAIGAGLFAITPLAKGGCAARRLSWVTPGFSQSRRCKTTAS 421 GR++ A + LAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 557 RNCWEGRSVRASSLLRRWRKG 495 RNCWEGRSVRASSLLR+ KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,223,790 Number of Sequences: 59808 Number of extensions: 570033 Number of successful extensions: 8801 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5653 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8477 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2407378809 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -