BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0653.Seq (816 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC10F6.03c |||CTP synthase |Schizosaccharomyces pombe|chr 1|||... 29 1.0 SPAC6F6.06c |rax2||cell polarity factor Rax2|Schizosaccharomyces... 27 3.2 SPAC1A6.07 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||... 26 5.6 SPAC6G10.05c |||TRAPP complex subunit Trs120 |Schizosaccharomyce... 26 7.4 SPCC1620.07c |||lunapark homolog|Schizosaccharomyces pombe|chr 3... 26 7.4 SPBPB10D8.02c |||arylsulfatase |Schizosaccharomyces pombe|chr 2|... 26 7.4 SPAC22H10.07 |scd2|ral3|scaffold protein Scd2|Schizosaccharomyce... 25 9.7 >SPAC10F6.03c |||CTP synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 600 Score = 28.7 bits (61), Expect = 1.0 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = -2 Query: 422 SVGGGAWPFLVGGAICLVNSGNERDSSLLNRRRYLGVRGLVSRNSLTT 279 ++ G L G + ++N G E D L N RYL V L N++TT Sbjct: 44 NIDAGTMSPLEHGEVFVLNDGGEVDLDLGNYERYLNVT-LTHDNNITT 90 >SPAC6F6.06c |rax2||cell polarity factor Rax2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1155 Score = 27.1 bits (57), Expect = 3.2 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 645 TYLRLELXRYLIASNSKFSFLNDENTFGKCFSLMF 749 +Y+RLE Y A+NS + L E KC + ++ Sbjct: 756 SYIRLEDIAYPFANNSMIAILGSEEMEDKCTAAVY 790 >SPAC1A6.07 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 636 Score = 26.2 bits (55), Expect = 5.6 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +1 Query: 520 VPFPSIL*VSALQPYSPRSPKSLVSRKLPAEP 615 VP P + V + Q Y P SP V PA+P Sbjct: 415 VPAPPMQPVQSTQYYQPSSPVQPVQNVKPAQP 446 >SPAC6G10.05c |||TRAPP complex subunit Trs120 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1210 Score = 25.8 bits (54), Expect = 7.4 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 374 DKSLHQLRTAMHHHPPNQERAVNLSILPV 460 D +LH + +H + E A NLSILP+ Sbjct: 1061 DDNLHHGEIYLRNHILSDEMANNLSILPI 1089 >SPCC1620.07c |||lunapark homolog|Schizosaccharomyces pombe|chr 3|||Manual Length = 334 Score = 25.8 bits (54), Expect = 7.4 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = -1 Query: 732 ICQXCFHHSRTKI*SSKRLDTAXVLTVNMSSNDPP 628 IC CFHH+ K D V + N PP Sbjct: 200 ICSHCFHHNGLASYGEKASDVRYVCLFCKAWNGPP 234 >SPBPB10D8.02c |||arylsulfatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 554 Score = 25.8 bits (54), Expect = 7.4 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +3 Query: 408 TTTHRIKKELLICQSFRCPGLVRFPVLSQIKP 503 T R+ K + RCP ++R+P L IKP Sbjct: 375 TAPSRLSKGFITEGGIRCPAIIRYPPL--IKP 404 >SPAC22H10.07 |scd2|ral3|scaffold protein Scd2|Schizosaccharomyces pombe|chr 1|||Manual Length = 536 Score = 25.4 bits (53), Expect = 9.7 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +3 Query: 501 PQSTPGGALPVNSLSFSFATILPPESKIFGFPEAA 605 P ST ALP LSFS P ++ PE+A Sbjct: 418 PTSTMPEALPREPLSFSLPEKAPEKATNISIPESA 452 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,325,580 Number of Sequences: 5004 Number of extensions: 68009 Number of successful extensions: 166 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 161 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 166 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 398435810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -