BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0653.Seq (816 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46117| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_21596| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 7e-15 SB_54484| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_47613| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 2e-13 SB_22783| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_30350| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_50595| Best HMM Match : Herpes_US9 (HMM E-Value=2.5) 64 2e-10 SB_45982| Best HMM Match : TIL (HMM E-Value=2.5) 60 2e-09 SB_16598| Best HMM Match : TIL (HMM E-Value=2.5) 60 2e-09 SB_12257| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_45011| Best HMM Match : FYVE (HMM E-Value=9.8) 60 2e-09 SB_55150| Best HMM Match : TIL (HMM E-Value=2.5) 60 3e-09 SB_49087| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_23403| Best HMM Match : FYVE (HMM E-Value=9.8) 59 4e-09 SB_56250| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_49567| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_9699| Best HMM Match : FYVE (HMM E-Value=9.8) 58 6e-09 SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 9e-09 SB_56296| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_48355| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) 57 2e-08 SB_17609| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) 57 2e-08 SB_11205| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_28753| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_45893| Best HMM Match : Arc (HMM E-Value=3.3) 54 1e-07 SB_51709| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_1551| Best HMM Match : WD40 (HMM E-Value=0.0019) 54 1e-07 SB_26770| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_19267| Best HMM Match : TIL (HMM E-Value=2.5) 53 3e-07 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 50 2e-06 SB_44725| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_9377| Best HMM Match : DUF1550 (HMM E-Value=4) 42 5e-04 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 40 0.002 SB_1081| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_34797| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_27909| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_4723| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_57065| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_23080| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_29700| Best HMM Match : DUF551 (HMM E-Value=8.8) 34 0.16 SB_26327| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_1546| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_13730| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_25769| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_41723| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_17617| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_6881| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_58054| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_42677| Best HMM Match : TUDOR (HMM E-Value=0) 29 4.5 SB_58476| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_58117| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_57051| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_56735| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_47630| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_42617| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_40153| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_36940| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_35936| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_22548| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_21972| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_21946| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_19156| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_18757| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_18471| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_8094| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_4926| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_57173| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_55458| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_52064| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_41855| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_41222| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_40101| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_30251| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_29656| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_25406| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_24218| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_20995| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_20749| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_20494| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_18082| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 29 6.0 SB_16129| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_14158| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_10058| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_6526| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_1429| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_1346| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_35857| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_19517| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 >SB_46117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 82.2 bits (194), Expect = 5e-16 Identities = 44/63 (69%), Positives = 47/63 (74%) Frame = -3 Query: 211 MPLDVLGRTRATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALIT 32 MPLDVL RTRATL S P P G GN +K RAGD LQL +NEEFLVSASH+LALIT Sbjct: 1 MPLDVLDRTRATLTVSRVFPSPEGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALIT 60 Query: 31 SLP 23 SLP Sbjct: 61 SLP 63 >SB_21596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 78.2 bits (184), Expect = 7e-15 Identities = 44/64 (68%), Positives = 48/64 (75%), Gaps = 1/64 (1%) Frame = -3 Query: 211 MPLDVLGRTRATLKESACSPWPR-GPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALI 35 MPLDVLGRTRATL S + R G GN +K RAGD LQL +NEEFLVSASH+LALI Sbjct: 1 MPLDVLGRTRATLTVSTSLSFARKGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALI 60 Query: 34 TSLP 23 TSLP Sbjct: 61 TSLP 64 >SB_54484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 75.4 bits (177), Expect = 5e-14 Identities = 41/63 (65%), Positives = 45/63 (71%) Frame = -3 Query: 211 MPLDVLGRTRATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALIT 32 MPLDVLGRTRATL S + G GN +K RAGD +L NEEFLVSASH+LALIT Sbjct: 1 MPLDVLGRTRATLTVSTSLSFAGGVGNLVKHRRAGDRSCKLLIFNEEFLVSASHQLALIT 60 Query: 31 SLP 23 SLP Sbjct: 61 SLP 63 >SB_47613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 73.7 bits (173), Expect = 2e-13 Identities = 42/64 (65%), Positives = 46/64 (71%), Gaps = 1/64 (1%) Frame = -3 Query: 211 MPLDVLGRTRATLKESACSPWPR-GPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALI 35 MPLDVLGR R TL S + R G GN +K RAGD LQL +NEEFLVSASH+LALI Sbjct: 1 MPLDVLGRPRVTLTVSTSLSFRRKGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALI 60 Query: 34 TSLP 23 TSLP Sbjct: 61 TSLP 64 >SB_22783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 72.9 bits (171), Expect = 3e-13 Identities = 42/64 (65%), Positives = 45/64 (70%), Gaps = 1/64 (1%) Frame = -3 Query: 211 MPLDVLGRTRA-TLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALI 35 MPLDVLGRTR T + P P G GN +K RAGD LQL NEEFLVSASH+LALI Sbjct: 1 MPLDVLGRTRRYTDGVNESFPRPEGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALI 60 Query: 34 TSLP 23 TSLP Sbjct: 61 TSLP 64 >SB_30350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 66.9 bits (156), Expect = 2e-11 Identities = 36/57 (63%), Positives = 39/57 (68%) Frame = -3 Query: 193 GRTRATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLP 23 GRTRATL P P G GN +K RAGD +L NEEFLVSASH+LALITSLP Sbjct: 4 GRTRATLTGQRVFPSPEGGGNLVKHRRAGDRSCKLLIFNEEFLVSASHQLALITSLP 60 >SB_50595| Best HMM Match : Herpes_US9 (HMM E-Value=2.5) Length = 101 Score = 63.7 bits (148), Expect = 2e-10 Identities = 39/64 (60%), Positives = 43/64 (67%), Gaps = 1/64 (1%) Frame = -3 Query: 211 MPLDVLGR-TRATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALI 35 MPLDVLGR R T + +G GN +K RAGD LQL NEEFLVSASH+LALI Sbjct: 1 MPLDVLGRHARYTDGVNESFLRRKGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALI 60 Query: 34 TSLP 23 TSLP Sbjct: 61 TSLP 64 >SB_45982| Best HMM Match : TIL (HMM E-Value=2.5) Length = 211 Score = 60.5 bits (140), Expect = 2e-09 Identities = 31/54 (57%), Positives = 39/54 (72%) Frame = -3 Query: 184 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLP 23 R ++++ C+ G GN +K RAGD LQL +NEEFLVSASH+LALITSLP Sbjct: 121 RKVIRKATCARCFAGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLP 174 >SB_16598| Best HMM Match : TIL (HMM E-Value=2.5) Length = 216 Score = 60.5 bits (140), Expect = 2e-09 Identities = 31/54 (57%), Positives = 39/54 (72%) Frame = -3 Query: 184 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLP 23 R ++++ C+ G GN +K RAGD LQL +NEEFLVSASH+LALITSLP Sbjct: 126 RKVIRKATCARCFAGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLP 179 >SB_12257| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 60.1 bits (139), Expect = 2e-09 Identities = 31/54 (57%), Positives = 38/54 (70%) Frame = -3 Query: 184 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLP 23 R +++ C+ G GN +K RAGD LQL +NEEFLVSASH+LALITSLP Sbjct: 165 RKVTRKATCARCFAGVGNLVKYRRAGDRSLQLLILNEEFLVSASHQLALITSLP 218 >SB_45011| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 163 Score = 60.1 bits (139), Expect = 2e-09 Identities = 31/54 (57%), Positives = 38/54 (70%) Frame = -3 Query: 184 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLP 23 R +++ C+ G GN +K RAGD LQL +NEEFLVSASH+LALITSLP Sbjct: 73 RKVTRKATCARCFAGVGNLVKYRRAGDRSLQLLILNEEFLVSASHQLALITSLP 126 >SB_55150| Best HMM Match : TIL (HMM E-Value=2.5) Length = 211 Score = 59.7 bits (138), Expect = 3e-09 Identities = 31/54 (57%), Positives = 38/54 (70%) Frame = -3 Query: 184 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLP 23 R ++++ C+ G GN +K RAGD LQL NEEFLVSASH+LALITSLP Sbjct: 121 RKVIRKATCARCFAGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLP 174 >SB_49087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 59.3 bits (137), Expect = 4e-09 Identities = 31/54 (57%), Positives = 38/54 (70%) Frame = -3 Query: 184 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLP 23 R +++ C+ G GN +K RAGD LQL +NEEFLVSASH+LALITSLP Sbjct: 73 RKVTRKATCARCFAGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLP 126 >SB_23403| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 137 Score = 59.3 bits (137), Expect = 4e-09 Identities = 31/54 (57%), Positives = 38/54 (70%) Frame = -3 Query: 184 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLP 23 R +++ C+ G GN +K RAGD LQL +NEEFLVSASH+LALITSLP Sbjct: 47 RKVTRKATCARCFAGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLP 100 >SB_56250| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 58.4 bits (135), Expect = 6e-09 Identities = 31/54 (57%), Positives = 37/54 (68%) Frame = -3 Query: 184 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLP 23 R +++ C+ G GN +K RAGD LQL NEEFLVSASH+LALITSLP Sbjct: 126 RKVTRKATCARCFAGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLP 179 >SB_49567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 58.4 bits (135), Expect = 6e-09 Identities = 31/54 (57%), Positives = 37/54 (68%) Frame = -3 Query: 184 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLP 23 R +++ C+ G GN +K RAGD LQL NEEFLVSASH+LALITSLP Sbjct: 73 RKVTRKATCARCFAGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLP 126 >SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 58.4 bits (135), Expect = 6e-09 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = -3 Query: 148 PRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLP 23 P+G GN +K RAGD LQL NEEFLVSASH+LALITSLP Sbjct: 102 PQGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLP 143 >SB_9699| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 163 Score = 58.4 bits (135), Expect = 6e-09 Identities = 31/54 (57%), Positives = 37/54 (68%) Frame = -3 Query: 184 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLP 23 R +++ C+ G GN +K RAGD LQL NEEFLVSASH+LALITSLP Sbjct: 73 RKVTRKATCARCFAGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLP 126 >SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 58.0 bits (134), Expect = 9e-09 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -3 Query: 148 PRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLP 23 P+G GN +K RAGD LQL +NEEFLVSA+H+LALITSLP Sbjct: 42 PQGVGNLVKHRRAGDRSLQLLILNEEFLVSANHQLALITSLP 83 >SB_56296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 57.6 bits (133), Expect = 1e-08 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -3 Query: 145 RGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLP 23 +G GN +K RAGD LQL +NEEFLVSASH+LALITSLP Sbjct: 67 KGVGNLVKYRRAGDRSLQLLILNEEFLVSASHQLALITSLP 107 >SB_48355| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) Length = 98 Score = 56.8 bits (131), Expect = 2e-08 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -3 Query: 145 RGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLP 23 +G GN +K RAGD LQL +NEEFLVSASH+LALITSLP Sbjct: 21 KGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLP 61 Score = 29.1 bits (62), Expect = 4.5 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = -2 Query: 200 CPGPHARYTEGIS 162 C GPHARYT+G++ Sbjct: 2 CSGPHARYTDGVN 14 >SB_17609| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) Length = 98 Score = 56.8 bits (131), Expect = 2e-08 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -3 Query: 145 RGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLP 23 +G GN +K RAGD LQL +NEEFLVSASH+LALITSLP Sbjct: 21 KGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLP 61 Score = 29.1 bits (62), Expect = 4.5 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = -2 Query: 200 CPGPHARYTEGIS 162 C GPHARYT+G++ Sbjct: 2 CSGPHARYTDGVN 14 >SB_11205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 56.0 bits (129), Expect = 3e-08 Identities = 30/54 (55%), Positives = 37/54 (68%) Frame = -3 Query: 184 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLP 23 R +++ C+ G GN +K RA D LQL +NEEFLVSASH+LALITSLP Sbjct: 73 RKVTRKATCARCFAGVGNLVKHRRARDRSLQLLILNEEFLVSASHQLALITSLP 126 >SB_28753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 55.2 bits (127), Expect = 6e-08 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = -3 Query: 142 GPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLP 23 G GN +K RAGD LQL NEEFLVSASH+LALITSLP Sbjct: 22 GVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLP 61 Score = 29.1 bits (62), Expect = 4.5 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = -2 Query: 200 CPGPHARYTEGIS 162 C GPHARYT+G++ Sbjct: 2 CSGPHARYTDGVN 14 >SB_45893| Best HMM Match : Arc (HMM E-Value=3.3) Length = 186 Score = 54.4 bits (125), Expect = 1e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -3 Query: 136 GNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLP 23 GN +K RAGD LQL +NEEFLVSASH+LALITSLP Sbjct: 3 GNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLP 40 >SB_51709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 54.4 bits (125), Expect = 1e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -3 Query: 136 GNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLP 23 GN +K RAGD LQL +NEEFLVSASH+LALITSLP Sbjct: 3 GNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLP 40 >SB_1551| Best HMM Match : WD40 (HMM E-Value=0.0019) Length = 101 Score = 54.4 bits (125), Expect = 1e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -3 Query: 136 GNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLP 23 GN +K RAGD LQL +NEEFLVSASH+LALITSLP Sbjct: 3 GNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLP 40 >SB_26770| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 53.6 bits (123), Expect = 2e-07 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = -3 Query: 136 GNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLP 23 GN +K RAGD LQL NEEFLVSASH+LALITSLP Sbjct: 3 GNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLP 40 >SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 53.6 bits (123), Expect = 2e-07 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = -3 Query: 136 GNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLP 23 GN +K RAGD LQL NEEFLVSASH+LALITSLP Sbjct: 3 GNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLP 40 >SB_19267| Best HMM Match : TIL (HMM E-Value=2.5) Length = 214 Score = 52.8 bits (121), Expect = 3e-07 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = -3 Query: 142 GPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLP 23 G GN +K RA D LQL +NEEFLVSASH+LALITSLP Sbjct: 138 GVGNLVKHRRARDRSLQLLILNEEFLVSASHQLALITSLP 177 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -3 Query: 115 RAGDWGLQLSPINEEFLVSASHKLALITSLP 23 RAGD LQL +NEEFLVSASH+LALITSLP Sbjct: 85 RAGDRSLQLLILNEEFLVSASHQLALITSLP 115 >SB_44725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 42.3 bits (95), Expect = 5e-04 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = -3 Query: 97 LQLSPINEEFLVSASHKLALITSLP 23 LQL NEEFLVSASH+LALITSLP Sbjct: 30 LQLLIFNEEFLVSASHQLALITSLP 54 >SB_9377| Best HMM Match : DUF1550 (HMM E-Value=4) Length = 91 Score = 42.3 bits (95), Expect = 5e-04 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = -3 Query: 97 LQLSPINEEFLVSASHKLALITSLP 23 LQL NEEFLVSASH+LALITSLP Sbjct: 30 LQLLIFNEEFLVSASHQLALITSLP 54 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/40 (55%), Positives = 26/40 (65%) Frame = +1 Query: 46 AYDSRLLGIPRLWGIIANPNPQHEGVSAGCPGL*ARENML 165 A DSRLLGIPR IIA PQH+ VS P L A+E ++ Sbjct: 85 ADDSRLLGIPRSRSIIAMIYPQHDDVSQDYPRLPAKERLV 124 >SB_1081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/20 (90%), Positives = 20/20 (100%) Frame = -3 Query: 82 INEEFLVSASHKLALITSLP 23 +NEEFLVSASH+LALITSLP Sbjct: 7 LNEEFLVSASHQLALITSLP 26 >SB_34797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 35.9 bits (79), Expect = 0.039 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 165 DSFSVARVRPRTSKGITD 218 D+ SVARVRPRTSKGITD Sbjct: 34 DTVSVARVRPRTSKGITD 51 >SB_27909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 35.9 bits (79), Expect = 0.039 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 165 DSFSVARVRPRTSKGITD 218 D+ SVARVRPRTSKGITD Sbjct: 132 DTVSVARVRPRTSKGITD 149 >SB_4723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 35.9 bits (79), Expect = 0.039 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 165 DSFSVARVRPRTSKGITD 218 D+ SVARVRPRTSKGITD Sbjct: 64 DTVSVARVRPRTSKGITD 81 >SB_57065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 35.9 bits (79), Expect = 0.039 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 165 DSFSVARVRPRTSKGITD 218 D+ SVARVRPRTSKGITD Sbjct: 64 DTVSVARVRPRTSKGITD 81 >SB_23080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 35.9 bits (79), Expect = 0.039 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 165 DSFSVARVRPRTSKGITD 218 D+ SVARVRPRTSKGITD Sbjct: 64 DTVSVARVRPRTSKGITD 81 >SB_29700| Best HMM Match : DUF551 (HMM E-Value=8.8) Length = 86 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +3 Query: 165 DSFSVARVRPRTSKGITD 218 D+ SVA VRPRTSKGITD Sbjct: 64 DTVSVAHVRPRTSKGITD 81 >SB_26327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -1 Query: 738 KSICQXCFHHSRTKI*SSKRLDTAXVLTVN 649 +SICQ CF + K+ +R DT VLT+N Sbjct: 14 ESICQECFINQERKLEDRRRSDTVLVLTIN 43 >SB_1546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -1 Query: 738 KSICQXCFHHSRTKI*SSKRLDTAXVLTVN 649 +SICQ CF + K+ +R DT VLT+N Sbjct: 14 ESICQECFINQERKLEDRRRSDTVLVLTIN 43 >SB_13730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -1 Query: 738 KSICQXCFHHSRTKI*SSKRLDTAXVLTVN 649 +SICQ CF + K+ +R DT VLT+N Sbjct: 14 ESICQECFINQERKLEDRRRSDTVLVLTIN 43 >SB_25769| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 31.5 bits (68), Expect = 0.84 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +3 Query: 165 DSFSVARVRPRTSKGITD 218 D+ SVARVR +TSKGITD Sbjct: 64 DTVSVARVRAKTSKGITD 81 >SB_41723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -3 Query: 211 MPLDVLGRTRATLKES 164 MPLDVLGRTRATL S Sbjct: 1 MPLDVLGRTRATLTVS 16 >SB_17617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -1 Query: 768 SWXSQDETSTKSICQXCFHHSRTKI*SSKRLDTAXVLTVN 649 SW + T+ K+ + F + K+ +R DT VLT+N Sbjct: 4 SWIYERRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 43 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 211 MPLDVLGRTRATL 173 MPLDVLGRTRATL Sbjct: 1 MPLDVLGRTRATL 13 >SB_6881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -1 Query: 738 KSICQXCFHHSRTKI*SSKRLDTAXVLTVN 649 +SICQ F + K+ +R DT VLT+N Sbjct: 14 ESICQDVFINQERKLEDRRRSDTVLVLTIN 43 >SB_58054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/29 (58%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = -2 Query: 758 RKTKHQRKAFAKXVFIIQERKF--RVRSD 678 R+ + KAFAK VFI QERK R RSD Sbjct: 26 RRARTTAKAFAKNVFINQERKLEDRRRSD 54 >SB_42677| Best HMM Match : TUDOR (HMM E-Value=0) Length = 1150 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = -3 Query: 184 RATLKESACSPWPRGPGNPLKLLRA---GDWGLQLSPINEEF 68 +AT+++ P+P G LK++ W L L PIN EF Sbjct: 325 KATVQKVYLKPYPLADGTSLKVIVTEVISPWELWLQPINTEF 366 >SB_58476| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_58117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_57051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_56735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_47630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_42617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_40153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_36940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 40 VSASHQLALITSLP 53 >SB_35936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_22548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_21972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_21946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_19156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_18757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_18471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_8094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_4926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_57173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_55458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_52064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_41855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_41222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_40101| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_30251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_29656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_25406| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_24218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_20995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_20749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_20494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_18082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) Length = 167 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 15 VSASHQLALITSLP 28 >SB_16129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_14158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_10058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_6526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_1429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 92 VSASHQLALITSLP 105 >SB_1346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 64 VSASHKLALITSLP 23 VSASH+LALITSLP Sbjct: 14 VSASHQLALITSLP 27 >SB_35857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2680 Score = 28.3 bits (60), Expect = 7.9 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +2 Query: 518 WCPSRQFFKFQLCNHTPPGVQNLWFPGSCPPSHCSNVGGSLDD 646 +C + + C+ PG + PGSC P +C N+ GSL D Sbjct: 842 YCQCKPNIGGRRCDRCMPG--SYGGPGSCKPCNC-NMAGSLSD 881 >SB_19517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1696 Score = 28.3 bits (60), Expect = 7.9 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 587 WFPGSCPPSHCSNVGGSLDDIFTVRTXAVS 676 W+PG CPP C+ +L + TV + +S Sbjct: 80 WYPGYCPPHKCAG-RNTLQECCTVYSPEIS 108 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,717,216 Number of Sequences: 59808 Number of extensions: 594072 Number of successful extensions: 1433 Number of sequences better than 10.0: 91 Number of HSP's better than 10.0 without gapping: 1228 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1427 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2275631710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -