BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0653.Seq (816 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 4.5 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 5.9 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 7.8 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.6 bits (46), Expect = 4.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -3 Query: 169 ESACSPWPRGPGNPLKLLRA 110 + + SP PR P NP++ L+A Sbjct: 13 DRSTSPLPRKPVNPVQELKA 32 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.2 bits (45), Expect = 5.9 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -3 Query: 595 GKPKILDSGGSMVAKLKLKELTGRAPPGVDC 503 GK + +D G + +LKEL G DC Sbjct: 1280 GKGERIDMNGKLRQSPRLKELVGATSIIKDC 1310 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.8 bits (44), Expect = 7.8 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 712 SFKNENLEFEAIRYRXSSNRKYVI*RSADVTTM 614 + KN EA+ Y + K ++ + DVTT+ Sbjct: 91 TLKNAGTPPEAVSYNVAVPTKSILEKKPDVTTV 123 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 238,344 Number of Sequences: 438 Number of extensions: 5538 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25974678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -