BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0651.Seq (755 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g18640.1 68416.m02368 zinc finger protein-related contains si... 28 7.7 At1g78995.1 68414.m09211 expressed protein 28 7.7 >At3g18640.1 68416.m02368 zinc finger protein-related contains similarity to zinc finger proteins (CCCH type) Length = 676 Score = 27.9 bits (59), Expect = 7.7 Identities = 25/93 (26%), Positives = 42/93 (45%) Frame = -1 Query: 392 RPISEIKVALIIFSRSFCVNIICGEDMNSNSNSVPFQIPSAFNYLRSKGLVLKLSRKSWN 213 R ++E VA S S VN+ E N N N++P+Q + L + G L+ + N Sbjct: 359 RTMAEKPVAASHQSYSNSVNVAPVETFNQNHNALPYQ-----SSLTAGGSQQVLAAAATN 413 Query: 212 FLLRI*PADKRFGTIVNQYFHIFVSK*TLIQHS 114 F + ++ G + H V K L+Q++ Sbjct: 414 FSVGSNLSNLESGKVYQDNHHSTVEKPVLVQNT 446 >At1g78995.1 68414.m09211 expressed protein Length = 159 Score = 27.9 bits (59), Expect = 7.7 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +2 Query: 506 FKSSTFCMTSCYELLNVIS*GTVGP 580 F+S +C+ C ++ N+I G GP Sbjct: 135 FRSRNYCLVECSDICNLIGDGDYGP 159 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,242,008 Number of Sequences: 28952 Number of extensions: 273270 Number of successful extensions: 502 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 497 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 502 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1682736544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -