BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0650.Seq (909 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8I1S6 Cluster: Glutamyl-tRNA(Gln) amidotransferase sub... 40 0.12 UniRef50_Q8C7Z9 Cluster: 0 day neonate cerebellum cDNA, RIKEN fu... 34 4.4 UniRef50_O77372 Cluster: Putative uncharacterized protein MAL3P6... 34 4.4 UniRef50_Q0M216 Cluster: Putative uncharacterized protein; n=1; ... 33 7.6 >UniRef50_Q8I1S6 Cluster: Glutamyl-tRNA(Gln) amidotransferase subunit A, putative; n=1; Plasmodium falciparum 3D7|Rep: Glutamyl-tRNA(Gln) amidotransferase subunit A, putative - Plasmodium falciparum (isolate 3D7) Length = 826 Score = 39.5 bits (88), Expect = 0.12 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 3/87 (3%) Frame = +3 Query: 279 IFNDLSCTPRK*KSTFTRFII*IDKMYYRNSLIIS--ISKVTFRYIKKK-LLVFYVNYIS 449 I N++ C+ K +F + K YY N+ S ++ +TF YI + L ++V+ I Sbjct: 508 IRNNVKCSDHKCGKRKIKFFSLLKKYYYSNTFQSSTPLNNITFGYINENNLKEYFVDDII 567 Query: 450 NKNNKSSMRAKKKRGSQNEFLSRPNCI 530 NKN + KK GS + + PN I Sbjct: 568 NKNYIYVIEGMKKLGSSFKQIELPNLI 594 >UniRef50_Q8C7Z9 Cluster: 0 day neonate cerebellum cDNA, RIKEN full-length enriched library, clone:C230071P17 product:hypothetical protein, full insert sequence; n=1; Mus musculus|Rep: 0 day neonate cerebellum cDNA, RIKEN full-length enriched library, clone:C230071P17 product:hypothetical protein, full insert sequence - Mus musculus (Mouse) Length = 126 Score = 34.3 bits (75), Expect = 4.4 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +2 Query: 317 IDIYPF-HHLNRQNVLSKFFNYFNQQSNISLYKKKTFSILC 436 +D++ H+N +N LSK YF +S I+L++ S LC Sbjct: 19 LDLFSLVQHINERNDLSKATRYFYMESEIALWRNTALSTLC 59 >UniRef50_O77372 Cluster: Putative uncharacterized protein MAL3P6.23; n=3; Eukaryota|Rep: Putative uncharacterized protein MAL3P6.23 - Plasmodium falciparum (isolate 3D7) Length = 4981 Score = 34.3 bits (75), Expect = 4.4 Identities = 23/82 (28%), Positives = 44/82 (53%) Frame = +3 Query: 273 KEIFNDLSCTPRK*KSTFTRFII*IDKMYYRNSLIISISKVTFRYIKKKLLVFYVNYISN 452 +EI D+ + K+ F + YY+ +++S K+T I KKL+ Y+ ++S+ Sbjct: 1318 EEINKDIKKKKMRKKTIFDKNEKISKACYYKQMILLSYKKIT-ESISKKLVHTYL-HVSS 1375 Query: 453 KNNKSSMRAKKKRGSQNEFLSR 518 N ++ ++KKR N+F+ R Sbjct: 1376 VNKHDNLSSRKKR-KINKFIKR 1396 >UniRef50_Q0M216 Cluster: Putative uncharacterized protein; n=1; Caulobacter sp. K31|Rep: Putative uncharacterized protein - Caulobacter sp. K31 Length = 154 Score = 33.5 bits (73), Expect = 7.6 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +1 Query: 28 GERGRGADETTRPDRNVSLRPSTVFASGNSDLGKCVSAK-RALAVHARAKCYRIQ 189 G R + D+ R D + + RP+ + A G+ + AK R LAV AR C+ IQ Sbjct: 77 GRRRQAGDDARRADHHATQRPAAIEALGHLLREQFGVAKHRRLAVKARELCFEIQ 131 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 845,430,486 Number of Sequences: 1657284 Number of extensions: 17043224 Number of successful extensions: 39424 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 37528 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39400 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 82801539422 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -