BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0649.Seq (712 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. 29 0.11 AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. 29 0.11 AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. 29 0.11 AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. 29 0.11 AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. 29 0.11 AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. 29 0.11 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 29 0.11 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 29 0.11 AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. 29 0.19 AY750997-1|AAV31069.1| 153|Anopheles gambiae peritrophin-1 prot... 28 0.33 AY344828-1|AAR02439.1| 153|Anopheles gambiae peritrophin A prot... 28 0.33 AY344827-1|AAR02438.1| 153|Anopheles gambiae peritrophin A prot... 28 0.33 AY344826-1|AAR02437.1| 153|Anopheles gambiae peritrophin A prot... 28 0.33 AY344825-1|AAR02436.1| 153|Anopheles gambiae peritrophin A prot... 28 0.33 AY344824-1|AAR02435.1| 153|Anopheles gambiae peritrophin A prot... 28 0.33 AY344823-1|AAR02434.1| 153|Anopheles gambiae peritrophin A prot... 28 0.33 AF030431-1|AAC39127.1| 153|Anopheles gambiae peritrophin 1 prot... 28 0.33 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 25 1.8 AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 prot... 25 3.1 DQ080909-1|AAY89555.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080908-1|AAY89554.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080907-1|AAY89553.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080906-1|AAY89552.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080905-1|AAY89551.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080904-1|AAY89550.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080903-1|AAY89549.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080902-1|AAY89548.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080901-1|AAY89547.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080900-1|AAY89546.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080899-1|AAY89545.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080898-1|AAY89544.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080897-1|AAY89543.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080896-1|AAY89542.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080894-1|AAY89540.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080893-1|AAY89539.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080892-1|AAY89538.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080891-1|AAY89537.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080890-1|AAY89536.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080889-1|AAY89535.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080888-1|AAY89534.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080887-1|AAY89533.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080886-1|AAY89532.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080885-1|AAY89531.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080884-1|AAY89530.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080883-1|AAY89529.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080882-1|AAY89528.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080881-1|AAY89527.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080880-1|AAY89526.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080879-1|AAY89525.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080878-1|AAY89524.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080877-1|AAY89523.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080876-1|AAY89522.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080875-1|AAY89521.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080874-1|AAY89520.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080873-1|AAY89519.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080872-1|AAY89518.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080871-1|AAY89517.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080870-1|AAY89516.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080869-1|AAY89515.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080868-1|AAY89514.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080867-1|AAY89513.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080866-1|AAY89512.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080865-1|AAY89511.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080864-1|AAY89510.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080863-1|AAY89509.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 DQ080862-1|AAY89508.1| 120|Anopheles gambiae olfactory receptor... 23 7.2 AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 pr... 23 7.2 >AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 29.5 bits (63), Expect = 0.11 Identities = 12/29 (41%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +3 Query: 87 QESFKCPDD-FGFYPHHISCDKYWKCDNG 170 QE CP G PH C K+ C+NG Sbjct: 214 QEELTCPPGVIGLRPHPTDCRKFLNCNNG 242 >AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 29.5 bits (63), Expect = 0.11 Identities = 12/29 (41%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +3 Query: 87 QESFKCPDD-FGFYPHHISCDKYWKCDNG 170 QE CP G PH C K+ C+NG Sbjct: 214 QEELTCPPGVIGLRPHPTDCRKFLNCNNG 242 >AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 29.5 bits (63), Expect = 0.11 Identities = 12/29 (41%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +3 Query: 87 QESFKCPDD-FGFYPHHISCDKYWKCDNG 170 QE CP G PH C K+ C+NG Sbjct: 213 QEELTCPPGVIGLRPHPTDCRKFLNCNNG 241 >AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 29.5 bits (63), Expect = 0.11 Identities = 12/29 (41%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +3 Query: 87 QESFKCPDD-FGFYPHHISCDKYWKCDNG 170 QE CP G PH C K+ C+NG Sbjct: 213 QEELTCPPGVIGLRPHPTDCRKFLNCNNG 241 >AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 29.5 bits (63), Expect = 0.11 Identities = 12/29 (41%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +3 Query: 87 QESFKCPDD-FGFYPHHISCDKYWKCDNG 170 QE CP G PH C K+ C+NG Sbjct: 213 QEELTCPPGVIGLRPHPTDCRKFLNCNNG 241 >AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 29.5 bits (63), Expect = 0.11 Identities = 12/29 (41%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +3 Query: 87 QESFKCPDD-FGFYPHHISCDKYWKCDNG 170 QE CP G PH C K+ C+NG Sbjct: 213 QEELTCPPGVIGLRPHPTDCRKFLNCNNG 241 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 29.5 bits (63), Expect = 0.11 Identities = 12/29 (41%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +3 Query: 87 QESFKCPDD-FGFYPHHISCDKYWKCDNG 170 QE CP G PH C K+ C+NG Sbjct: 285 QEELTCPPGVIGLRPHPTDCRKFLNCNNG 313 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 29.5 bits (63), Expect = 0.11 Identities = 12/29 (41%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +3 Query: 87 QESFKCPDD-FGFYPHHISCDKYWKCDNG 170 QE CP G PH C K+ C+NG Sbjct: 284 QEELTCPPGVIGLRPHPTDCRKFLNCNNG 312 >AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. Length = 525 Score = 28.7 bits (61), Expect = 0.19 Identities = 16/58 (27%), Positives = 21/58 (36%), Gaps = 1/58 (1%) Frame = +1 Query: 289 PPISTPHCSR-LYGIFPDENKCDVFWNCWNGEASRLSVQPRTLLTTEKSRVCMWADQV 459 PP C+ YG P C ++ C + P L +C WADQV Sbjct: 463 PPSGDGPCAGGRYGFVPHPTNCARYYICLTADTYYEFTCPPGTLFDPALHICNWADQV 520 Score = 24.6 bits (51), Expect = 3.1 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +3 Query: 114 FGFYPHHISCDKYWKC 161 +GF PH +C +Y+ C Sbjct: 475 YGFVPHPTNCARYYIC 490 >AY750997-1|AAV31069.1| 153|Anopheles gambiae peritrophin-1 protein. Length = 153 Score = 27.9 bits (59), Expect = 0.33 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 105 PDDFGFYPHHISCDKYWKCD 164 PD + PH C KY+ CD Sbjct: 101 PDHMVYIPHETDCGKYYICD 120 >AY344828-1|AAR02439.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 27.9 bits (59), Expect = 0.33 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 105 PDDFGFYPHHISCDKYWKCD 164 PD + PH C KY+ CD Sbjct: 101 PDHMVYIPHETDCGKYYICD 120 >AY344827-1|AAR02438.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 27.9 bits (59), Expect = 0.33 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 105 PDDFGFYPHHISCDKYWKCD 164 PD + PH C KY+ CD Sbjct: 101 PDHMVYIPHETDCGKYYICD 120 >AY344826-1|AAR02437.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 27.9 bits (59), Expect = 0.33 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 105 PDDFGFYPHHISCDKYWKCD 164 PD + PH C KY+ CD Sbjct: 101 PDHMVYIPHETDCGKYYICD 120 >AY344825-1|AAR02436.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 27.9 bits (59), Expect = 0.33 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 105 PDDFGFYPHHISCDKYWKCD 164 PD + PH C KY+ CD Sbjct: 101 PDHMVYIPHETDCGKYYICD 120 >AY344824-1|AAR02435.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 27.9 bits (59), Expect = 0.33 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 105 PDDFGFYPHHISCDKYWKCD 164 PD + PH C KY+ CD Sbjct: 101 PDHMVYIPHETDCGKYYICD 120 >AY344823-1|AAR02434.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 27.9 bits (59), Expect = 0.33 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 105 PDDFGFYPHHISCDKYWKCD 164 PD + PH C KY+ CD Sbjct: 101 PDHMVYIPHETDCGKYYICD 120 >AF030431-1|AAC39127.1| 153|Anopheles gambiae peritrophin 1 protein. Length = 153 Score = 27.9 bits (59), Expect = 0.33 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 105 PDDFGFYPHHISCDKYWKCD 164 PD + PH C KY+ CD Sbjct: 101 PDHMVYIPHETDCGKYYICD 120 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 25.4 bits (53), Expect = 1.8 Identities = 15/47 (31%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +3 Query: 90 ESFKCPDDFGFYPHHISCDKYWKCDNGVAN*KPAATVSLS-TPQIPN 227 + FKCPD + CD Y G + PA + S T Q P+ Sbjct: 318 KEFKCPDGLYWNDQQKRCDSYSSSQCGCPDIPPAPNMWPSMTSQTPS 364 >AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 protein. Length = 107 Score = 24.6 bits (51), Expect = 3.1 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -3 Query: 200 DRCRRFSVRYTVVALPVFVTGDVVRVETEVVGAFEG 93 D C + +Y + ++P F+ ++ EVVG F G Sbjct: 61 DECEELAAQYNIASMPTFL---FIK-RKEVVGQFSG 92 >DQ080909-1|AAY89555.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080908-1|AAY89554.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080907-1|AAY89553.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080906-1|AAY89552.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080905-1|AAY89551.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080904-1|AAY89550.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080903-1|AAY89549.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080902-1|AAY89548.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080901-1|AAY89547.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080900-1|AAY89546.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080899-1|AAY89545.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080898-1|AAY89544.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080897-1|AAY89543.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080896-1|AAY89542.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080894-1|AAY89540.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080893-1|AAY89539.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080892-1|AAY89538.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080891-1|AAY89537.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080890-1|AAY89536.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080889-1|AAY89535.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080888-1|AAY89534.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080887-1|AAY89533.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080886-1|AAY89532.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080885-1|AAY89531.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080884-1|AAY89530.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080883-1|AAY89529.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080882-1|AAY89528.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080881-1|AAY89527.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080880-1|AAY89526.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080879-1|AAY89525.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080878-1|AAY89524.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080877-1|AAY89523.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080876-1|AAY89522.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080875-1|AAY89521.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080874-1|AAY89520.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080873-1|AAY89519.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080872-1|AAY89518.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080871-1|AAY89517.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080870-1|AAY89516.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080869-1|AAY89515.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080868-1|AAY89514.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080867-1|AAY89513.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080866-1|AAY89512.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080865-1|AAY89511.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080864-1|AAY89510.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080863-1|AAY89509.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >DQ080862-1|AAY89508.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 497 FGCQPPVKVFQRW 535 FGC PP ++ +RW Sbjct: 32 FGCWPPDRLTRRW 44 >AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 protein. Length = 505 Score = 23.4 bits (48), Expect = 7.2 Identities = 11/15 (73%), Positives = 12/15 (80%), Gaps = 1/15 (6%) Frame = +1 Query: 478 KKXAKRIRLPT-PGE 519 KK AKR+RLP PGE Sbjct: 231 KKLAKRLRLPVLPGE 245 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 681,861 Number of Sequences: 2352 Number of extensions: 13082 Number of successful extensions: 97 Number of sequences better than 10.0: 67 Number of HSP's better than 10.0 without gapping: 95 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 97 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72758970 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -