BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0649.Seq (712 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL603750-1|CAH72669.1| 1116|Homo sapiens synapse defective 1, Rh... 31 3.1 Z83067-1|CAB05445.1| 1455|Homo sapiens FAA protein. 30 7.1 X99226-1|CAA67610.1| 1455|Homo sapiens Fanconi anemia complement... 30 7.1 AY598423-1|AAS99350.1| 1429|Homo sapiens Fanconi anemia, complem... 30 7.1 AC005360-1|AAC28751.1| 846|Homo sapiens FAA protein. 30 7.1 BC139920-1|AAI39921.1| 407|Homo sapiens CHIA protein protein. 30 9.4 BC139901-1|AAI39902.1| 407|Homo sapiens CHIA protein protein. 30 9.4 BC106910-1|AAI06911.1| 368|Homo sapiens chitinase, acidic protein. 30 9.4 BC047336-1|AAH47336.2| 368|Homo sapiens chitinase, acidic protein. 30 9.4 BC036339-1|AAH36339.2| 368|Homo sapiens chitinase, acidic protein. 30 9.4 BC032109-1|AAH32109.1| 859|Homo sapiens low density lipoprotein... 30 9.4 AY911310-1|AAX81433.1| 315|Homo sapiens chitinase family protei... 30 9.4 AY825504-1|AAX54833.1| 430|Homo sapiens chitinase family protei... 30 9.4 AY789445-1|AAX81432.1| 315|Homo sapiens chitinase family protei... 30 9.4 AY789444-1|AAX81431.1| 368|Homo sapiens chitinase family protei... 30 9.4 AL513202-5|CAH70804.1| 405|Homo sapiens eosinophil chemotactic ... 30 9.4 AL513202-4|CAH70803.1| 476|Homo sapiens eosinophil chemotactic ... 30 9.4 AL513202-3|CAH70802.1| 420|Homo sapiens eosinophil chemotactic ... 30 9.4 AL356387-9|CAI19266.1| 405|Homo sapiens eosinophil chemotactic ... 30 9.4 AL356387-8|CAI19265.1| 476|Homo sapiens eosinophil chemotactic ... 30 9.4 AL356387-6|CAI19263.1| 420|Homo sapiens eosinophil chemotactic ... 30 9.4 AF290004-1|AAG60019.1| 476|Homo sapiens acidic mammalian chitin... 30 9.4 AF166350-1|AAD44360.1| 859|Homo sapiens ST7 protein protein. 30 9.4 AB208957-1|BAD92194.1| 793|Homo sapiens suppression of tumorige... 30 9.4 AB025009-1|BAA86981.1| 315|Homo sapiens novel member of chitina... 30 9.4 AB025008-1|BAA86980.1| 368|Homo sapiens novel member of chitina... 30 9.4 >AL603750-1|CAH72669.1| 1116|Homo sapiens synapse defective 1, Rho GTPase, homolog 2 (C. elegans) protein. Length = 1116 Score = 31.5 bits (68), Expect = 3.1 Identities = 21/53 (39%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Frame = +2 Query: 113 LRFLPSPHLL*QILEV---RQRCSELKTCGNGLAFDATDSKYLTENCDYLPTL 262 LR LPSP + Q+ E S LK NG D DSKY + D LP + Sbjct: 819 LRELPSPLITKQLYEAVLDAMAKSPLKMSSNGCENDPGDSKYTVDLLDCLPEI 871 >Z83067-1|CAB05445.1| 1455|Homo sapiens FAA protein. Length = 1455 Score = 30.3 bits (65), Expect = 7.1 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +1 Query: 241 LRLPSNVECGERTQLEPPISTPHCSRLYGIFPDE 342 LRLPS+V CG Q E PI T C + + + E Sbjct: 1083 LRLPSSVLCGSSFQAEQPI-TARCEQFFHLVNSE 1115 >X99226-1|CAA67610.1| 1455|Homo sapiens Fanconi anemia complementation group A protein protein. Length = 1455 Score = 30.3 bits (65), Expect = 7.1 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +1 Query: 241 LRLPSNVECGERTQLEPPISTPHCSRLYGIFPDE 342 LRLPS+V CG Q E PI T C + + + E Sbjct: 1083 LRLPSSVLCGSSFQAEQPI-TARCEQFFHLVNSE 1115 >AY598423-1|AAS99350.1| 1429|Homo sapiens Fanconi anemia, complementation group A protein. Length = 1429 Score = 30.3 bits (65), Expect = 7.1 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +1 Query: 241 LRLPSNVECGERTQLEPPISTPHCSRLYGIFPDE 342 LRLPS+V CG Q E PI T C + + + E Sbjct: 1057 LRLPSSVLCGSSFQAEQPI-TARCEQFFHLVNSE 1089 >AC005360-1|AAC28751.1| 846|Homo sapiens FAA protein. Length = 846 Score = 30.3 bits (65), Expect = 7.1 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +1 Query: 241 LRLPSNVECGERTQLEPPISTPHCSRLYGIFPDE 342 LRLPS+V CG Q E PI T C + + + E Sbjct: 474 LRLPSSVLCGSSFQAEQPI-TARCEQFFHLVNSE 506 >BC139920-1|AAI39921.1| 407|Homo sapiens CHIA protein protein. Length = 407 Score = 29.9 bits (64), Expect = 9.4 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +1 Query: 316 RLYGIFPDENKCDVFWNCWNGEASRLSVQPRTLLTTEKSRVCMWA 450 R G++P N + FW+C NG + + Q + T C WA Sbjct: 364 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDT-SCDCCNWA 407 >BC139901-1|AAI39902.1| 407|Homo sapiens CHIA protein protein. Length = 407 Score = 29.9 bits (64), Expect = 9.4 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +1 Query: 316 RLYGIFPDENKCDVFWNCWNGEASRLSVQPRTLLTTEKSRVCMWA 450 R G++P N + FW+C NG + + Q + T C WA Sbjct: 364 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDT-SCDCCNWA 407 >BC106910-1|AAI06911.1| 368|Homo sapiens chitinase, acidic protein. Length = 368 Score = 29.9 bits (64), Expect = 9.4 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +1 Query: 316 RLYGIFPDENKCDVFWNCWNGEASRLSVQPRTLLTTEKSRVCMWA 450 R G++P N + FW+C NG + + Q + T C WA Sbjct: 325 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDT-SCDCCNWA 368 >BC047336-1|AAH47336.2| 368|Homo sapiens chitinase, acidic protein. Length = 368 Score = 29.9 bits (64), Expect = 9.4 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +1 Query: 316 RLYGIFPDENKCDVFWNCWNGEASRLSVQPRTLLTTEKSRVCMWA 450 R G++P N + FW+C NG + + Q + T C WA Sbjct: 325 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDT-SCDCCNWA 368 >BC036339-1|AAH36339.2| 368|Homo sapiens chitinase, acidic protein. Length = 368 Score = 29.9 bits (64), Expect = 9.4 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +1 Query: 316 RLYGIFPDENKCDVFWNCWNGEASRLSVQPRTLLTTEKSRVCMWA 450 R G++P N + FW+C NG + + Q + T C WA Sbjct: 325 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDT-SCDCCNWA 368 >BC032109-1|AAH32109.1| 859|Homo sapiens low density lipoprotein-related protein 12 protein. Length = 859 Score = 29.9 bits (64), Expect = 9.4 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 102 CPDDFGFYPHHISCDKYWKCDNG 170 C ++G Y CD YW C NG Sbjct: 382 CGGNWGCYTEQQRCDGYWHCPNG 404 >AY911310-1|AAX81433.1| 315|Homo sapiens chitinase family protein V1 protein. Length = 315 Score = 29.9 bits (64), Expect = 9.4 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +1 Query: 316 RLYGIFPDENKCDVFWNCWNGEASRLSVQPRTLLTTEKSRVCMWA 450 R G++P N + FW+C NG + + Q + T C WA Sbjct: 272 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDT-SCDCCNWA 315 >AY825504-1|AAX54833.1| 430|Homo sapiens chitinase family protein 3 protein. Length = 430 Score = 29.9 bits (64), Expect = 9.4 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +1 Query: 316 RLYGIFPDENKCDVFWNCWNGEASRLSVQPRTLLTTEKSRVCMWA 450 R G++P N + FW+C NG + + Q + T C WA Sbjct: 387 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDT-SCDCCNWA 430 >AY789445-1|AAX81432.1| 315|Homo sapiens chitinase family protein 2 protein. Length = 315 Score = 29.9 bits (64), Expect = 9.4 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +1 Query: 316 RLYGIFPDENKCDVFWNCWNGEASRLSVQPRTLLTTEKSRVCMWA 450 R G++P N + FW+C NG + + Q + T C WA Sbjct: 272 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDT-SCDCCNWA 315 >AY789444-1|AAX81431.1| 368|Homo sapiens chitinase family protein 1 protein. Length = 368 Score = 29.9 bits (64), Expect = 9.4 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +1 Query: 316 RLYGIFPDENKCDVFWNCWNGEASRLSVQPRTLLTTEKSRVCMWA 450 R G++P N + FW+C NG + + Q + T C WA Sbjct: 325 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDT-SCDCCNWA 368 >AL513202-5|CAH70804.1| 405|Homo sapiens eosinophil chemotactic cytokine (CHIA) protein. Length = 405 Score = 29.9 bits (64), Expect = 9.4 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +1 Query: 316 RLYGIFPDENKCDVFWNCWNGEASRLSVQPRTLLTTEKSRVCMWA 450 R G++P N + FW+C NG + + Q + T C WA Sbjct: 362 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDT-SCDCCNWA 405 >AL513202-4|CAH70803.1| 476|Homo sapiens eosinophil chemotactic cytokine (CHIA) protein. Length = 476 Score = 29.9 bits (64), Expect = 9.4 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +1 Query: 316 RLYGIFPDENKCDVFWNCWNGEASRLSVQPRTLLTTEKSRVCMWA 450 R G++P N + FW+C NG + + Q + T C WA Sbjct: 433 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDT-SCDCCNWA 476 >AL513202-3|CAH70802.1| 420|Homo sapiens eosinophil chemotactic cytokine (CHIA) protein. Length = 420 Score = 29.9 bits (64), Expect = 9.4 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +1 Query: 316 RLYGIFPDENKCDVFWNCWNGEASRLSVQPRTLLTTEKSRVCMWA 450 R G++P N + FW+C NG + + Q + T C WA Sbjct: 377 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDT-SCDCCNWA 420 >AL356387-9|CAI19266.1| 405|Homo sapiens eosinophil chemotactic cytokine (CHIA) protein. Length = 405 Score = 29.9 bits (64), Expect = 9.4 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +1 Query: 316 RLYGIFPDENKCDVFWNCWNGEASRLSVQPRTLLTTEKSRVCMWA 450 R G++P N + FW+C NG + + Q + T C WA Sbjct: 362 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDT-SCDCCNWA 405 >AL356387-8|CAI19265.1| 476|Homo sapiens eosinophil chemotactic cytokine (CHIA) protein. Length = 476 Score = 29.9 bits (64), Expect = 9.4 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +1 Query: 316 RLYGIFPDENKCDVFWNCWNGEASRLSVQPRTLLTTEKSRVCMWA 450 R G++P N + FW+C NG + + Q + T C WA Sbjct: 433 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDT-SCDCCNWA 476 >AL356387-6|CAI19263.1| 420|Homo sapiens eosinophil chemotactic cytokine (CHIA) protein. Length = 420 Score = 29.9 bits (64), Expect = 9.4 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +1 Query: 316 RLYGIFPDENKCDVFWNCWNGEASRLSVQPRTLLTTEKSRVCMWA 450 R G++P N + FW+C NG + + Q + T C WA Sbjct: 377 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDT-SCDCCNWA 420 >AF290004-1|AAG60019.1| 476|Homo sapiens acidic mammalian chitinase precursor protein. Length = 476 Score = 29.9 bits (64), Expect = 9.4 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +1 Query: 316 RLYGIFPDENKCDVFWNCWNGEASRLSVQPRTLLTTEKSRVCMWA 450 R G++P N + FW+C NG + + Q + T C WA Sbjct: 433 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDT-SCDCCNWA 476 >AF166350-1|AAD44360.1| 859|Homo sapiens ST7 protein protein. Length = 859 Score = 29.9 bits (64), Expect = 9.4 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 102 CPDDFGFYPHHISCDKYWKCDNG 170 C ++G Y CD YW C NG Sbjct: 382 CGGNWGCYTEQQRCDGYWHCPNG 404 >AB208957-1|BAD92194.1| 793|Homo sapiens suppression of tumorigenicity variant protein. Length = 793 Score = 29.9 bits (64), Expect = 9.4 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 102 CPDDFGFYPHHISCDKYWKCDNG 170 C ++G Y CD YW C NG Sbjct: 316 CGGNWGCYTEQQRCDGYWHCPNG 338 >AB025009-1|BAA86981.1| 315|Homo sapiens novel member of chitinase family protein. Length = 315 Score = 29.9 bits (64), Expect = 9.4 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +1 Query: 316 RLYGIFPDENKCDVFWNCWNGEASRLSVQPRTLLTTEKSRVCMWA 450 R G++P N + FW+C NG + + Q + T C WA Sbjct: 272 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDT-SCDCCNWA 315 >AB025008-1|BAA86980.1| 368|Homo sapiens novel member of chitinase family protein. Length = 368 Score = 29.9 bits (64), Expect = 9.4 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +1 Query: 316 RLYGIFPDENKCDVFWNCWNGEASRLSVQPRTLLTTEKSRVCMWA 450 R G++P N + FW+C NG + + Q + T C WA Sbjct: 325 RANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDT-SCDCCNWA 368 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,611,466 Number of Sequences: 237096 Number of extensions: 2183460 Number of successful extensions: 5592 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 4959 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5592 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8287202872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -