BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0647.Seq (919 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439398-1|CAD28124.1| 208|Anopheles gambiae hypothetical prote... 27 1.1 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 25 3.2 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 25 3.2 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 25 3.2 AJ441131-2|CAD29631.1| 208|Anopheles gambiae hypothetical prote... 25 4.2 DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfat... 24 5.6 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 24 7.4 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 24 7.4 AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylch... 24 7.4 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 23 9.8 AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. 23 9.8 AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. 23 9.8 AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. 23 9.8 AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. 23 9.8 AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. 23 9.8 AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. 23 9.8 >AJ439398-1|CAD28124.1| 208|Anopheles gambiae hypothetical protein protein. Length = 208 Score = 26.6 bits (56), Expect = 1.1 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +2 Query: 371 NVINVFMSE*VRARGRERPPLICHLCWKTEVDYSSFDERTSY 496 N N +S+ ++ + R PP H C +TE D + RT + Sbjct: 156 NTYNARLSKLMQEKTRNAPPERGHRCGRTESDNAKTRRRTRH 197 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 25.0 bits (52), Expect = 3.2 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 225 NTSDDTTNNKYNTIKNRQNTNES 157 N ++ ++NN NTI + N N S Sbjct: 202 NNNNSSSNNNNNTISSNNNNNNS 224 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 25.0 bits (52), Expect = 3.2 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 225 NTSDDTTNNKYNTIKNRQNTNES 157 N ++ ++NN NTI + N N S Sbjct: 202 NNNNSSSNNNNNTISSNNNNNNS 224 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 25.0 bits (52), Expect = 3.2 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 225 NTSDDTTNNKYNTIKNRQNTNES 157 N ++ ++NN NTI + N N S Sbjct: 154 NNNNSSSNNNNNTISSNNNNNNS 176 >AJ441131-2|CAD29631.1| 208|Anopheles gambiae hypothetical protein protein. Length = 208 Score = 24.6 bits (51), Expect = 4.2 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = +2 Query: 371 NVINVFMSE*VRARGRERPPLICHLCWKTEVDYSSFDERTSY 496 N N +S+ ++ + R PP H C +TE D + R + Sbjct: 156 NTYNARLSKLMQEKTRNAPPERGHRCGRTESDNAKTRRRARH 197 >DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfatase precursor protein. Length = 525 Score = 24.2 bits (50), Expect = 5.6 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +2 Query: 23 QYALCATKDSNSLE*ERMIAAAILDSFLYWR 115 Q ALCA ++ L R + D + YWR Sbjct: 75 QQALCAPSRNSMLTGRRPDTVRLYDFYSYWR 105 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 23.8 bits (49), Expect = 7.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -2 Query: 225 NTSDDTTNNKYNTIKNRQNTNES 157 N ++ + NN NTI + N N S Sbjct: 202 NNNNSSGNNNNNTISSNNNNNNS 224 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 23.8 bits (49), Expect = 7.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +2 Query: 422 RPPLICHLCWKTEVDYSSFDERT 490 RPP I + +V+Y FDE+T Sbjct: 139 RPPAIYKSSCEIDVEYFPFDEQT 161 >AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 1 protein. Length = 557 Score = 23.8 bits (49), Expect = 7.4 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +2 Query: 422 RPPLICHLCWKTEVDYSSFDERTSYL 499 +PP I + +V+Y FDE+T ++ Sbjct: 139 KPPAIYKSFCEIDVEYFPFDEQTCFM 164 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.4 bits (48), Expect = 9.8 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 422 RPPLICHLCWKTEVDYSSFDERTSYL 499 +PP I + +V+Y FDE+T L Sbjct: 143 KPPAIYKSSCEIDVEYFPFDEQTCVL 168 >AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.4 bits (48), Expect = 9.8 Identities = 12/52 (23%), Positives = 23/52 (44%) Frame = -1 Query: 472 GIINLSLPTQMTNQRGAFTSAGPHSFTHKYIYNIAPSILLSVNYTHKKSYMP 317 G +S + +RG+ T + S H +++ S L +N+T + P Sbjct: 59 GAYTISAEPLIVGRRGSGTISNKLSLQHVQLFDYEESEYLCMNFTSNQKLDP 110 >AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.4 bits (48), Expect = 9.8 Identities = 12/52 (23%), Positives = 23/52 (44%) Frame = -1 Query: 472 GIINLSLPTQMTNQRGAFTSAGPHSFTHKYIYNIAPSILLSVNYTHKKSYMP 317 G +S + +RG+ T + S H +++ S L +N+T + P Sbjct: 59 GAYTISAEPLIVGRRGSGTISNKLSLQHVQLFDYEESEYLCMNFTSNQKLDP 110 >AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.4 bits (48), Expect = 9.8 Identities = 12/52 (23%), Positives = 23/52 (44%) Frame = -1 Query: 472 GIINLSLPTQMTNQRGAFTSAGPHSFTHKYIYNIAPSILLSVNYTHKKSYMP 317 G +S + +RG+ T + S H +++ S L +N+T + P Sbjct: 59 GAYTISAEPLIVGRRGSGTISNKLSLQHVQLFDYEESEYLCMNFTSNQKLDP 110 >AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.4 bits (48), Expect = 9.8 Identities = 12/52 (23%), Positives = 23/52 (44%) Frame = -1 Query: 472 GIINLSLPTQMTNQRGAFTSAGPHSFTHKYIYNIAPSILLSVNYTHKKSYMP 317 G +S + +RG+ T + S H +++ S L +N+T + P Sbjct: 59 GAYTISAEPLIVGRRGSGTISNKLSLQHVQLFDYEESEYLCMNFTSNQKLDP 110 >AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.4 bits (48), Expect = 9.8 Identities = 12/52 (23%), Positives = 23/52 (44%) Frame = -1 Query: 472 GIINLSLPTQMTNQRGAFTSAGPHSFTHKYIYNIAPSILLSVNYTHKKSYMP 317 G +S + +RG+ T + S H +++ S L +N+T + P Sbjct: 59 GAYTISAEPLIVGRRGSGTISNKLSLQHVQLFDYEESEYLCMNFTSNQKLDP 110 >AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. Length = 576 Score = 23.4 bits (48), Expect = 9.8 Identities = 12/52 (23%), Positives = 23/52 (44%) Frame = -1 Query: 472 GIINLSLPTQMTNQRGAFTSAGPHSFTHKYIYNIAPSILLSVNYTHKKSYMP 317 G +S + +RG+ T + S H +++ S L +N+T + P Sbjct: 286 GAYTISAEPLIVGRRGSGTISNKLSLQHVQLFDYEESEYLCMNFTSNQKLDP 337 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 837,132 Number of Sequences: 2352 Number of extensions: 14987 Number of successful extensions: 46 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 99641691 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -