BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0643.Seq (726 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1687.19c |||queuine tRNA-ribosyltransferase|Schizosaccharomy... 74 2e-14 SPAC2F3.13c |||queuine tRNA-ribosyltransferase |Schizosaccharomy... 30 0.39 SPAC20G8.09c |||N-acetyltransferase Nat10 |Schizosaccharomyces p... 28 1.6 SPAC11D3.18c |||nicotinic acid plasma membrane transporter |Schi... 26 4.8 SPAC631.01c |acp2||F-actin capping protein beta subunit |Schizos... 25 8.3 >SPAC1687.19c |||queuine tRNA-ribosyltransferase|Schizosaccharomyces pombe|chr 1|||Manual Length = 404 Score = 74.1 bits (174), Expect = 2e-14 Identities = 33/69 (47%), Positives = 48/69 (69%) Frame = +2 Query: 311 RARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQEIM 490 RAR + G+VE+P FMPVGT ++KG+ PE+++A G +I+L NT+HL L+PGQE++ Sbjct: 20 RARVTDIQLPHGLVESPVFMPVGTQASLKGVLPEQLDALGCKIMLNNTYHLGLKPGQEVL 79 Query: 491 KLHGRFARF 517 G RF Sbjct: 80 DTVGGAHRF 88 >SPAC2F3.13c |||queuine tRNA-ribosyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 348 Score = 29.9 bits (64), Expect = 0.39 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 314 ARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVE 421 AR + V++TPCF + GTV +TP+ VE Sbjct: 12 ARVSSVTVKNKVLKTPCFFLPTSRGTVPHLTPDNVE 47 >SPAC20G8.09c |||N-acetyltransferase Nat10 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1033 Score = 27.9 bits (59), Expect = 1.6 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +1 Query: 16 GFQYKVVDALVTNFHLPESTLIMLV 90 G QYK +D L F+LP + L+ ++ Sbjct: 874 GLQYKTIDTLEKEFNLPSNQLLAML 898 >SPAC11D3.18c |||nicotinic acid plasma membrane transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 498 Score = 26.2 bits (55), Expect = 4.8 Identities = 12/48 (25%), Positives = 22/48 (45%) Frame = -3 Query: 391 GAVGANRHKTRRFHYATIKDQAATACATVGGVQFKFHFFSIRQKNSQR 248 G V ++++ + + C VGG+ + FFS+R N +R Sbjct: 426 GIVAGQIYRSKNAPKYILGNAFTLGCVIVGGLAYVVMFFSLRYVNKKR 473 >SPAC631.01c |acp2||F-actin capping protein beta subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 268 Score = 25.4 bits (53), Expect = 8.3 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 288 NFIFSPYVRKTANVLNQRRGITP 220 NF+ Y KT +++NQ R I P Sbjct: 226 NFLQDVYFGKTKDIINQTRSIQP 248 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,869,536 Number of Sequences: 5004 Number of extensions: 55736 Number of successful extensions: 125 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 125 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 341222980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -