BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0643.Seq (726 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 25 0.73 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 5.1 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 25.0 bits (52), Expect = 0.73 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +2 Query: 371 PVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQEIMK 493 PV YG VK ++PE+ E + N + +P +E +K Sbjct: 321 PVSPYGYVKPISPEQEELIHRLVYFQNEYE---QPSEEDLK 358 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 22.2 bits (45), Expect = 5.1 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -3 Query: 487 DFLARAQPQVEGVAEDNLRASGFN 416 DF R P + GV E R GF+ Sbjct: 237 DFSKRFSPAIRGVVEFAKRIPGFS 260 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,705 Number of Sequences: 438 Number of extensions: 3794 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -