BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0642.Seq (897 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC25B8.05 |||pseudouridylate synthase |Schizosaccharomyces pom... 27 3.6 SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|ch... 26 6.3 >SPAC25B8.05 |||pseudouridylate synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 450 Score = 27.1 bits (57), Expect = 3.6 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +2 Query: 185 FSIRYWSWNYRGCWHQTCPPIVPLKIFKVYSFRLR 289 F Y WNY G +Q P +P KV+ LR Sbjct: 96 FKFAYCGWNYNGLAYQLEPTPLPTVEGKVFEALLR 130 >SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 845 Score = 26.2 bits (55), Expect = 6.3 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = +1 Query: 274 LIPITRPRKSPVSLFFVTTSPCREWVICAPAAFL 375 +IPI + KS +SL F+T SPC + IC+ A L Sbjct: 45 IIPIAQ--KSNISLPFLTLSPC-SFTICSLRARL 75 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,152,008 Number of Sequences: 5004 Number of extensions: 59278 Number of successful extensions: 117 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 452494940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -