BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0642.Seq (897 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF042732-2|AAC18057.1| 179|Anopheles gambiae TU37B2 protein. 26 1.4 CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 26 1.8 >AF042732-2|AAC18057.1| 179|Anopheles gambiae TU37B2 protein. Length = 179 Score = 26.2 bits (55), Expect = 1.4 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -2 Query: 512 EGNSWIVARRTSAKAFAKGVFINQERKLEVRR 417 EG +W++ RT KG Q +KLE R+ Sbjct: 20 EGLTWVMVYRTEKYQKLKGEVEKQSKKLEKRK 51 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 25.8 bits (54), Expect = 1.8 Identities = 17/61 (27%), Positives = 30/61 (49%) Frame = -1 Query: 513 RGKFLDRRKTNISESICQRCFHQSRTKVRGSKAIR*EGA*ETATTSKEGSRRANYPLPAR 334 R K L + + S S+ + SR++ RGS++ + + ++ R+ PLPAR Sbjct: 409 RSKSLSKSSRSRSRSLSRSV---SRSRSRGSRSRSRTSQSRSRSKTRTSRSRSRTPLPAR 465 Query: 333 G 331 G Sbjct: 466 G 466 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 799,236 Number of Sequences: 2352 Number of extensions: 15619 Number of successful extensions: 47 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 96747534 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -