BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0642.Seq (897 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68337-3|CAA92750.2| 712|Caenorhabditis elegans Hypothetical pr... 29 4.5 AF077545-1|AAC26306.2| 506|Caenorhabditis elegans Hypothetical ... 28 7.9 >Z68337-3|CAA92750.2| 712|Caenorhabditis elegans Hypothetical protein M7.3 protein. Length = 712 Score = 29.1 bits (62), Expect = 4.5 Identities = 16/54 (29%), Positives = 24/54 (44%) Frame = +2 Query: 158 NYELFNRNNFSIRYWSWNYRGCWHQTCPPIVPLKIFKVYSFRLRGLVRVPYRYF 319 N+ FN + WN + W++ CP K+ KV F+ GL+R F Sbjct: 273 NFGKFNIKKVVDFFGFWNIQKTWNKKCP-----KVLKVPQFKSYGLLRTESNKF 321 >AF077545-1|AAC26306.2| 506|Caenorhabditis elegans Hypothetical protein H41C03.3 protein. Length = 506 Score = 28.3 bits (60), Expect = 7.9 Identities = 14/40 (35%), Positives = 17/40 (42%) Frame = +2 Query: 95 CSANVSVSPRMRAXDSAAHKCNYELFNRNNFSIRYWSWNY 214 C NV + P + DSA H N +N I WNY Sbjct: 211 CLPNVLLLPDEESVDSAGHNINLAHYNCLRVLINKPGWNY 250 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,809,534 Number of Sequences: 27780 Number of extensions: 339823 Number of successful extensions: 771 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 745 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 771 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2276333906 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -