BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0642.Seq (897 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g61690.1 68414.m06958 tetratricopeptide repeat (TPR)-containi... 28 7.3 >At1g61690.1 68414.m06958 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515: TPR Domain Length = 1155 Score = 28.3 bits (60), Expect = 7.3 Identities = 18/62 (29%), Positives = 30/62 (48%) Frame = -2 Query: 518 TLEGNSWIVARRTSAKAFAKGVFINQERKLEVRRRLDEREPEKRLPHPRKAAGAQITHSR 339 +L GNSW+V ++ FIN++++L +R + D P + +K A R Sbjct: 12 SLRGNSWVVDASHCQGCSSQFTFINRKQRLSLRGQGD--SPVRICEPCKKIEEAARFELR 69 Query: 338 HG 333 HG Sbjct: 70 HG 71 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,670,112 Number of Sequences: 28952 Number of extensions: 316298 Number of successful extensions: 655 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 642 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 655 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2110422216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -