BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0637.Seq (907 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 24 1.7 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 22 8.8 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 24.2 bits (50), Expect = 1.7 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = +2 Query: 116 VPVIVEKAPKVALGDLDKKKYLVPSDLTVGQFYFLIRKRIHLR---PEDDFSS 265 VP V KV D+ + VP D G++ L +H+R PED + + Sbjct: 126 VPSFVADFVKVLSWHTDQGEEFVPGDDYDGKYLVLPSGELHIRDVGPEDGYKT 178 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 21.8 bits (44), Expect = 8.8 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +3 Query: 690 VSRYYIPWAVVLPTVVTW 743 VSR++ P++ ++ VV W Sbjct: 362 VSRFFFPFSFLILNVVYW 379 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 243,976 Number of Sequences: 438 Number of extensions: 5369 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29388177 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -