BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0632.Seq (387 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 25 0.30 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 23 1.2 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 2.1 DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein ... 22 2.8 AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein ... 22 2.8 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 22 2.8 AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding prote... 21 3.7 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 3.7 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 3.7 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 4.9 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 20 8.6 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 20 8.6 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 25.0 bits (52), Expect = 0.30 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = -2 Query: 383 APREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHAGVLTATSVSA 234 +P S+ + L+ + + + Q NSP + P H+G +TS +A Sbjct: 33 SPATASLESSLSAAAVAAAAVNYAQQHNSPSPTGSSPQHSGSSASTSPAA 82 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 23.0 bits (47), Expect = 1.2 Identities = 18/76 (23%), Positives = 31/76 (40%), Gaps = 4/76 (5%) Frame = -2 Query: 305 SNSPPGSVLEPDHAGVLTATSVSATSPLCTLG----TKHRAPADIIDRAPLPPNRVSNET 138 S++P GS P A S + C+LG T A + DR+ P+ ++ Sbjct: 148 SSAPTGSSCGPGAAAAAALLSKRRSVSECSLGTASSTSSTASSRNSDRSAGSPSVSESDE 207 Query: 137 MKVVVFQRRSRETISH 90 + V+ + +T H Sbjct: 208 VDVIGYTSNQSDTDDH 223 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 22.2 bits (45), Expect = 2.1 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 111 SSLKNHYFHCFITYSVGRK 167 SS +FHC+ GRK Sbjct: 420 SSFFQQFFHCYCPVRFGRK 438 >DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein 1 protein. Length = 116 Score = 21.8 bits (44), Expect = 2.8 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +3 Query: 90 VGDRFARSSLKNHYFHCFI 146 + + A L+N Y+ CFI Sbjct: 32 IDEILANDRLRNQYYDCFI 50 >AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein protein. Length = 116 Score = 21.8 bits (44), Expect = 2.8 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +3 Query: 90 VGDRFARSSLKNHYFHCFI 146 + + A L+N Y+ CFI Sbjct: 32 IDEILANDRLRNQYYDCFI 50 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 21.8 bits (44), Expect = 2.8 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -3 Query: 118 SDDRAKRSPTYATPLMSPYNARLESSSTGSSFPADSP 8 +D R SP TP+ + Y +E+ + S F D+P Sbjct: 21 NDKRIYLSPR--TPIKNVYKNNIETKNQLSPFNIDTP 55 >AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding protein ASP5 protein. Length = 143 Score = 21.4 bits (43), Expect = 3.7 Identities = 13/49 (26%), Positives = 21/49 (42%) Frame = -2 Query: 167 LPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQCQTRVKLNRVFFP 21 +PP V K +V R+ E C ++ +QC + + FFP Sbjct: 97 MPPEEVV--IGKEIVAVCRNEEYTGDDCQKTYQYVQCHYKQNPEKFFFP 143 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 3.7 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -3 Query: 85 ATPLMSPYNARLESSSTGSSFP 20 A + SP + SSTGSS P Sbjct: 347 AKQMASPEPPKSSESSTGSSIP 368 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 3.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +2 Query: 236 RKRSSPLKLPRDPVRGHCQAGSLTG 310 R SP+ + DP+ A +LTG Sbjct: 454 RSAESPMSVQVDPMAASVVAAALTG 478 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.0 bits (42), Expect = 4.9 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 Query: 16 QRGKKTLLSLTLVWHCKE 69 + G KTLLS T +W ++ Sbjct: 231 KNGMKTLLSETDIWEVEQ 248 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 20.2 bits (40), Expect = 8.6 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -1 Query: 321 RCTAPVKLPAW 289 R AP K+PAW Sbjct: 62 RFKAPQKIPAW 72 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 20.2 bits (40), Expect = 8.6 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -1 Query: 321 RCTAPVKLPAW 289 R AP K+PAW Sbjct: 62 RFKAPQKIPAW 72 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,570 Number of Sequences: 438 Number of extensions: 2231 Number of successful extensions: 12 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9391092 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -