BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0629.Seq (883 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39210| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_46117| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_34797| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_27909| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_4723| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_57065| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_29700| Best HMM Match : DUF551 (HMM E-Value=8.8) 29 5.0 SB_23080| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 >SB_39210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 378 Score = 30.3 bits (65), Expect = 2.2 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 4/54 (7%) Frame = -3 Query: 797 KKGTXELGFKTRLEDQVXFLPL---LNWLXSFAIS*IL-LXLREEPAVFGPFGF 648 +KG E GFKT +D+V F+P+ L + I L L+E PA GP F Sbjct: 324 RKGCREFGFKTGYKDRVRFIPIHDAARTLGPKVCAAIAGLHLKELPAANGPSFF 377 >SB_46117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -1 Query: 82 MPXDVLGRMXATLKESACSPWPRGPGN 2 MP DVL R ATL S P P G GN Sbjct: 1 MPLDVLDRTRATLTVSRVFPSPEGVGN 27 >SB_34797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +3 Query: 36 DSFSVAXXRPRTSXGITD 89 D+ SVA RPRTS GITD Sbjct: 34 DTVSVARVRPRTSKGITD 51 >SB_27909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +3 Query: 36 DSFSVAXXRPRTSXGITD 89 D+ SVA RPRTS GITD Sbjct: 132 DTVSVARVRPRTSKGITD 149 >SB_4723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +3 Query: 36 DSFSVAXXRPRTSXGITD 89 D+ SVA RPRTS GITD Sbjct: 64 DTVSVARVRPRTSKGITD 81 >SB_57065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +3 Query: 36 DSFSVAXXRPRTSXGITD 89 D+ SVA RPRTS GITD Sbjct: 64 DTVSVARVRPRTSKGITD 81 >SB_29700| Best HMM Match : DUF551 (HMM E-Value=8.8) Length = 86 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +3 Query: 36 DSFSVAXXRPRTSXGITD 89 D+ SVA RPRTS GITD Sbjct: 64 DTVSVAHVRPRTSKGITD 81 >SB_23080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +3 Query: 36 DSFSVAXXRPRTSXGITD 89 D+ SVA RPRTS GITD Sbjct: 64 DTVSVARVRPRTSKGITD 81 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,087,629 Number of Sequences: 59808 Number of extensions: 568253 Number of successful extensions: 1251 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1156 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1250 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2514529411 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -