BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0629.Seq (883 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g46130.1 68416.m04992 myb family transcription factor (MYB48)... 29 5.4 At2g45050.1 68415.m05608 zinc finger (GATA type) family protein ... 28 9.5 >At3g46130.1 68416.m04992 myb family transcription factor (MYB48) contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 256 Score = 28.7 bits (61), Expect = 5.4 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 492 KSHCLDLPTLGAPQWSISL 548 +SHCL P L +P W SL Sbjct: 202 QSHCLSYPNLASPSWESSL 220 >At2g45050.1 68415.m05608 zinc finger (GATA type) family protein identical to cDNA GATA transcription factor 2 GI:2959731 Length = 264 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = -3 Query: 650 FMHSPKRPLXAKATHPRDYA*TPSKARSQPSRIRQGYAPLWSP 522 F P PL T + P K RS+ SR +A WSP Sbjct: 90 FADFPANPLGGTMTSVKTETSFPGKPRSKRSRAPAPFAGTWSP 132 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,639,849 Number of Sequences: 28952 Number of extensions: 385083 Number of successful extensions: 829 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 804 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 829 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2077687200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -