BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0628.Seq (826 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC18B5.10c |||TREX complex subunit Tex1 |Schizosaccharomyces p... 27 2.4 SPAC4D7.03 |pop2|sud1|F-box/WD repeat protein Pop2|Schizosacchar... 27 4.3 >SPCC18B5.10c |||TREX complex subunit Tex1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 309 Score = 27.5 bits (58), Expect = 2.4 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 361 DAVSGIGTDEEAIIEILCTLSNYGIRTISAFYEQLY 468 DA++ + +E I E T +Y IRT+S Y+ Y Sbjct: 215 DAITSLWDPQELICERSITRMDYPIRTLSFSYDSRY 250 >SPAC4D7.03 |pop2|sud1|F-box/WD repeat protein Pop2|Schizosaccharomyces pombe|chr 1|||Manual Length = 703 Score = 26.6 bits (56), Expect = 4.3 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 Query: 573 PWFFHRRIGHAQTTRTIS 520 P+F H IGH + RTIS Sbjct: 497 PYFVHTLIGHTDSVRTIS 514 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,975,698 Number of Sequences: 5004 Number of extensions: 55848 Number of successful extensions: 136 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 136 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 404442380 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -