BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0619.Seq (816 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC664.09 |ggt1||gamma-glutamyltranspeptidase Ggt1 |Schizosacch... 27 2.4 SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr... 25 9.7 >SPAC664.09 |ggt1||gamma-glutamyltranspeptidase Ggt1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 630 Score = 27.5 bits (58), Expect = 2.4 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +2 Query: 422 ALPNLIALQHIPLSPAGVIA--KRPAPIALPTVAXLNGEWQIV 544 A P ++ + SP IA KRP A+PT+ NGE ++V Sbjct: 485 ASPGIVNAFGLSPSPYNFIAPGKRPQSSAVPTILVYNGEVEMV 527 >SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1275 Score = 25.4 bits (53), Expect = 9.7 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 5/58 (8%) Frame = +2 Query: 347 PIRPIVSRITIHWPSFYNVVTGKTLALPNLIALQ-----HIPLSPAGVIAKRPAPIAL 505 P P+ S ++ H + + +L N I+L ++PLSP A+ P+PI L Sbjct: 172 PRPPLPSSVSSHSSPYSTTSSTSLYSLYNDISLSCSPEPYLPLSPTRSPARTPSPIRL 229 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,970,808 Number of Sequences: 5004 Number of extensions: 55237 Number of successful extensions: 105 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 105 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 398435810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -