BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0617.Seq (907 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12256| Best HMM Match : TP1 (HMM E-Value=8.5) 38 0.015 SB_45856| Best HMM Match : DUF755 (HMM E-Value=4.7) 37 0.019 SB_46955| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_25877| Best HMM Match : TP1 (HMM E-Value=8.5) 34 0.18 SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) 32 0.55 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 32 0.73 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 32 0.73 SB_45983| Best HMM Match : HLH (HMM E-Value=1.3) 31 0.97 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 31 0.97 SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.97 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.97 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.97 SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) 31 1.3 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_3953| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) 31 1.7 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 31 1.7 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 30 2.2 SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 30 3.0 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 30 3.0 SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) 30 3.0 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) 30 3.0 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 30 3.0 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 29 3.9 SB_31629| Best HMM Match : DEAD (HMM E-Value=1.2e-05) 29 3.9 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) 29 6.8 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 29 6.8 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 29 6.8 SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_14675| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_9104| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_41016| Best HMM Match : RPEL (HMM E-Value=8.9) 28 9.0 SB_39882| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.0 SB_36405| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.0 SB_28599| Best HMM Match : MSSP (HMM E-Value=6.8) 28 9.0 SB_10424| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.0 SB_52707| Best HMM Match : RPEL (HMM E-Value=8.9) 28 9.0 SB_38461| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=6.5) 28 9.0 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 28 9.0 SB_30254| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.0 SB_23268| Best HMM Match : HEAT (HMM E-Value=0.31) 28 9.0 SB_8500| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.0 >SB_12256| Best HMM Match : TP1 (HMM E-Value=8.5) Length = 156 Score = 37.5 bits (83), Expect = 0.015 Identities = 25/59 (42%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = -2 Query: 363 IFXLRWSLPPA*GCTLKQPDSKERPSRRDPPSLRAWPLYGKTAPFKTNLDRSR-RDEKA 190 IF RWSLPP GC KQPDS + + R+ P L T L R R R E A Sbjct: 75 IFSFRWSLPPILGCIPKQPDSSK--AHRERPRSPQTGLSPSTTCCSKQLGRPRIRRESA 131 >SB_45856| Best HMM Match : DUF755 (HMM E-Value=4.7) Length = 187 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/29 (62%), Positives = 19/29 (65%), Gaps = 4/29 (13%) Frame = -2 Query: 363 IFXLRWSLPPA*GCTLKQPDS----KERP 289 IF RWSLPP GC KQPDS +ERP Sbjct: 106 IFSFRWSLPPILGCIPKQPDSSKAHRERP 134 >SB_46955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 34.3 bits (75), Expect = 0.14 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -2 Query: 351 RWSLPPA*GCTLKQPDSKERPSRR 280 RWSLPP GC KQPDS + +R Sbjct: 35 RWSLPPILGCIPKQPDSSKAHRKR 58 >SB_25877| Best HMM Match : TP1 (HMM E-Value=8.5) Length = 139 Score = 33.9 bits (74), Expect = 0.18 Identities = 23/55 (41%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = -2 Query: 351 RWSLPPA*GCTLKQPDSKERPSRRDPPSLRAWPLYGKTAPFKTNLDRSR-RDEKA 190 RWSLPP GC KQPDS + + R+ P L T L R R R E A Sbjct: 62 RWSLPPILGCIPKQPDSSK--AHRERPRSPQTGLSPSTTCCSKQLGRPRIRRESA 114 >SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 32.7 bits (71), Expect = 0.42 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = +3 Query: 3 ALELVDPPGCRGRITR 50 ALELVDPPGCR IT+ Sbjct: 12 ALELVDPPGCRNSITK 27 >SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = -3 Query: 371 PRSYLXLDGVYHPLRAALSSNPTLR 297 PRS LDGVYHP AA +NPT R Sbjct: 55 PRS--ALDGVYHPFWAAFPNNPTRR 77 >SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) Length = 411 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = -3 Query: 371 PRSYLXLDGVYHPLRAALSSNPTLR 297 PRS LDGVYHP AA +NPT R Sbjct: 341 PRS--ALDGVYHPFWAAFPNNPTRR 363 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 31.9 bits (69), Expect = 0.73 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 3 ALELVDPPGCRGRIT 47 ALELVDPPGCR IT Sbjct: 69 ALELVDPPGCRNSIT 83 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 31.9 bits (69), Expect = 0.73 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 3 ALELVDPPGCRGRIT 47 ALELVDPPGCR IT Sbjct: 99 ALELVDPPGCRNSIT 113 >SB_45983| Best HMM Match : HLH (HMM E-Value=1.3) Length = 68 Score = 31.5 bits (68), Expect = 0.97 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -3 Query: 353 LDGVYHPLRAALSSNPTLR 297 LDGVYHP AA +NPT R Sbjct: 2 LDGVYHPFWAAFPNNPTRR 20 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 31.5 bits (68), Expect = 0.97 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = +3 Query: 3 ALELVDPPGCRGRITR 50 ALELVDPPGCR I R Sbjct: 12 ALELVDPPGCRNSIKR 27 >SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 31.5 bits (68), Expect = 0.97 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +3 Query: 3 ALELVDPPGCRGRITRR 53 ALELVDPPGCR I R Sbjct: 12 ALELVDPPGCRNSIDNR 28 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 31.5 bits (68), Expect = 0.97 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +3 Query: 3 ALELVDPPGCRGRITRRI 56 ALELVDPPGCR I ++ Sbjct: 12 ALELVDPPGCRNSIVTKV 29 >SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 31.5 bits (68), Expect = 0.97 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +3 Query: 3 ALELVDPPGCRGRITRR 53 ALELVDPPGCR I R Sbjct: 12 ALELVDPPGCRNSIINR 28 >SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) Length = 171 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +3 Query: 3 ALELVDPPGCRGRITR 50 ALELVDPPGCR I++ Sbjct: 12 ALELVDPPGCRNSISK 27 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +3 Query: 3 ALELVDPPGCRGRITRR 53 ALELVDPPGCR I R Sbjct: 12 ALELVDPPGCRNSIQAR 28 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +3 Query: 3 ALELVDPPGCRGRITRRI 56 ALELVDPPGCR + R+ Sbjct: 75 ALELVDPPGCRNSMDSRV 92 >SB_3953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 31.1 bits (67), Expect = 1.3 Identities = 20/33 (60%), Positives = 22/33 (66%), Gaps = 2/33 (6%) Frame = +2 Query: 5 SRTSGSPGLQGEDHPPNL-SILVSGGK-ETNQD 97 SRTSGSPGLQ D PN S VSG + T+QD Sbjct: 12 SRTSGSPGLQEFDSNPNRPSNAVSGDQATTSQD 44 >SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) Length = 106 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +3 Query: 3 ALELVDPPGCRGRITRR 53 ALELVDPPGCR + +R Sbjct: 12 ALELVDPPGCRNSMKQR 28 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +3 Query: 3 ALELVDPPGCRGRITRRI 56 ALELVDPPGCR I + + Sbjct: 99 ALELVDPPGCRNSIQQMV 116 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = +3 Query: 3 ALELVDPPGCRGRIT 47 ALELVDPPGCR I+ Sbjct: 12 ALELVDPPGCRNSIS 26 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = -3 Query: 371 PRSYLXLDGVYHPLRAALSSNPTLR 297 PRS LDG YHP AA +NPT R Sbjct: 55 PRS--ALDGFYHPFWAAFPNNPTRR 77 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = +3 Query: 3 ALELVDPPGCRGRITR 50 ALELVDPPGCR I + Sbjct: 12 ALELVDPPGCRNSIAQ 27 >SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +3 Query: 3 ALELVDPPGCRGRITRRI 56 ALELVDPPGCR I + + Sbjct: 12 ALELVDPPGCRNSIHKAL 29 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = +3 Query: 3 ALELVDPPGCRGRIT 47 ALELVDPPGCR I+ Sbjct: 656 ALELVDPPGCRNSIS 670 >SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +3 Query: 3 ALELVDPPGCRGRITRRI*AY**AEEKKLTRI 98 ALELVDPPGCR + ++ + AE+ + ++ Sbjct: 12 ALELVDPPGCRNSMKMKVESIDGAEKLDIPKV 43 >SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 3 ALELVDPPGCRGRI 44 ALELVDPPGCR I Sbjct: 12 ALELVDPPGCRNSI 25 >SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 3 ALELVDPPGCRGRI 44 ALELVDPPGCR I Sbjct: 12 ALELVDPPGCRNSI 25 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 3 ALELVDPPGCRGRI 44 ALELVDPPGCR I Sbjct: 12 ALELVDPPGCRNSI 25 >SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 3 ALELVDPPGCRGRI 44 ALELVDPPGCR I Sbjct: 12 ALELVDPPGCRNSI 25 >SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 3 ALELVDPPGCRGRI 44 ALELVDPPGCR I Sbjct: 12 ALELVDPPGCRNSI 25 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 3 ALELVDPPGCRGRI 44 ALELVDPPGCR I Sbjct: 12 ALELVDPPGCRNSI 25 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 3 ALELVDPPGCRGRI 44 ALELVDPPGCR I Sbjct: 29 ALELVDPPGCRNSI 42 >SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) Length = 205 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 3 ALELVDPPGCRGRI 44 ALELVDPPGCR I Sbjct: 12 ALELVDPPGCRNSI 25 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 3 ALELVDPPGCRGRI 44 ALELVDPPGCR I Sbjct: 12 ALELVDPPGCRNSI 25 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 3 ALELVDPPGCRGRI 44 ALELVDPPGCR I Sbjct: 12 ALELVDPPGCRNSI 25 >SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 3 ALELVDPPGCRGRI 44 ALELVDPPGCR I Sbjct: 12 ALELVDPPGCRNSI 25 >SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) Length = 123 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 3 ALELVDPPGCRGRI 44 ALELVDPPGCR I Sbjct: 12 ALELVDPPGCRNSI 25 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 3 ALELVDPPGCRGRI 44 ALELVDPPGCR I Sbjct: 29 ALELVDPPGCRNSI 42 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 3 ALELVDPPGCRGRI 44 ALELVDPPGCR I Sbjct: 12 ALELVDPPGCRNSI 25 >SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 3 ALELVDPPGCRGRI 44 ALELVDPPGCR I Sbjct: 12 ALELVDPPGCRNSI 25 >SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 3 ALELVDPPGCRGRI 44 ALELVDPPGCR I Sbjct: 12 ALELVDPPGCRNSI 25 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 3 ALELVDPPGCRGRI 44 ALELVDPPGCR I Sbjct: 12 ALELVDPPGCRNSI 25 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 3 ALELVDPPGCRGRI 44 ALELVDPPGCR I Sbjct: 12 ALELVDPPGCRNSI 25 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 3 ALELVDPPGCRGRI 44 ALELVDPPGCR I Sbjct: 49 ALELVDPPGCRNSI 62 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 3 ALELVDPPGCRGRI 44 ALELVDPPGCR I Sbjct: 88 ALELVDPPGCRNSI 101 >SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 29.5 bits (63), Expect = 3.9 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +3 Query: 3 ALELVDPPGCRGRITR 50 ALELVDPPGCR +++ Sbjct: 12 ALELVDPPGCRNSMSQ 27 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 29.5 bits (63), Expect = 3.9 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = +3 Query: 3 ALELVDPPGCRGRITRR 53 ALELVDPPGCR + R Sbjct: 32 ALELVDPPGCRNSMPDR 48 >SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 29.5 bits (63), Expect = 3.9 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +3 Query: 3 ALELVDPPGCRGRITRRI*AY 65 ALELVDPPGCR ++ A+ Sbjct: 12 ALELVDPPGCRNSMSNPFAAF 32 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 29.5 bits (63), Expect = 3.9 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +3 Query: 3 ALELVDPPGCRGRITRRI 56 ALELVDPPGCR + + Sbjct: 12 ALELVDPPGCRNSMNANV 29 >SB_31629| Best HMM Match : DEAD (HMM E-Value=1.2e-05) Length = 415 Score = 29.5 bits (63), Expect = 3.9 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +3 Query: 9 ELVDPPGCRGRITR 50 ELVDPPGCR IT+ Sbjct: 319 ELVDPPGCRNSITK 332 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 52 RRVILPLQPGGSTSSRA 2 RR+I LQPGGSTSSRA Sbjct: 18 RRLIEFLQPGGSTSSRA 34 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 3 ALELVDPPGCR 35 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 3 ALELVDPPGCR 35 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 3 ALELVDPPGCR 35 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 3 ALELVDPPGCR 35 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 3 ALELVDPPGCR 35 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 3 ALELVDPPGCR 35 ALELVDPPGCR Sbjct: 88 ALELVDPPGCR 98 >SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 3 ALELVDPPGCR 35 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) Length = 182 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 3 ALELVDPPGCR 35 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 3 ALELVDPPGCR 35 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 3 ALELVDPPGCR 35 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 3 ALELVDPPGCR 35 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 3 ALELVDPPGCR 35 ALELVDPPGCR Sbjct: 67 ALELVDPPGCR 77 >SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) Length = 171 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 3 ALELVDPPGCR 35 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 3 ALELVDPPGCR 35 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 3 ALELVDPPGCR 35 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_14675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 52 RRVILPLQPGGSTSSRA 2 R++I LQPGGSTSSRA Sbjct: 12 RKIIEFLQPGGSTSSRA 28 >SB_9104| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 55 IRRVILPLQPGGSTSSRA 2 + RVI LQPGGSTSSRA Sbjct: 22 VLRVIEFLQPGGSTSSRA 39 >SB_41016| Best HMM Match : RPEL (HMM E-Value=8.9) Length = 148 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 311 CLRVQP*AGGKLHLRXNM 364 CL +QP GGKLHL+ N+ Sbjct: 62 CLGMQPKMGGKLHLKLNI 79 >SB_39882| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 311 CLRVQP*AGGKLHLRXNM 364 CL +QP GGKLHL+ N+ Sbjct: 8 CLGMQPKMGGKLHLKLNI 25 >SB_36405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 55 IRRVILPLQPGGSTSSRA 2 I R+I LQPGGSTSSRA Sbjct: 20 ISRLIEFLQPGGSTSSRA 37 >SB_28599| Best HMM Match : MSSP (HMM E-Value=6.8) Length = 148 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 311 CLRVQP*AGGKLHLRXNM 364 CL +QP GGKLHL+ N+ Sbjct: 62 CLGMQPKMGGKLHLKLNI 79 >SB_10424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 311 CLRVQP*AGGKLHLRXNM 364 CL +QP GGKLHL+ N+ Sbjct: 36 CLGMQPKMGGKLHLKLNI 53 >SB_52707| Best HMM Match : RPEL (HMM E-Value=8.9) Length = 147 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 311 CLRVQP*AGGKLHLRXNM 364 CL +QP GGKLHL+ N+ Sbjct: 61 CLGMQPKMGGKLHLKLNI 78 >SB_38461| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=6.5) Length = 207 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -1 Query: 49 RVILPLQPGGSTSSRA 2 RVI LQPGGSTSSRA Sbjct: 82 RVIEFLQPGGSTSSRA 97 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 311 CLRVQP*AGGKLHLRXNM 364 CL +QP GGKLHL+ N+ Sbjct: 120 CLGMQPKMGGKLHLKLNI 137 >SB_30254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 311 CLRVQP*AGGKLHLRXNM 364 CL +QP GGKLHL+ N+ Sbjct: 19 CLGMQPKMGGKLHLKLNI 36 >SB_23268| Best HMM Match : HEAT (HMM E-Value=0.31) Length = 154 Score = 28.3 bits (60), Expect = 9.0 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 5 SRTSGSPGLQGEDHPPNL 58 SRTSGSPGLQ D P L Sbjct: 12 SRTSGSPGLQEFDRMPTL 29 >SB_8500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3408 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 311 CLRVQP*AGGKLHLRXNM 364 CL +QP GGKLHL+ N+ Sbjct: 725 CLGMQPKMGGKLHLKLNI 742 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,337,925 Number of Sequences: 59808 Number of extensions: 470442 Number of successful extensions: 1718 Number of sequences better than 10.0: 80 Number of HSP's better than 10.0 without gapping: 1642 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1716 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2609867019 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -