BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0617.Seq (907 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger pr... 27 0.59 AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinestera... 25 2.4 AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinestera... 25 2.4 AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinestera... 25 2.4 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 24 5.5 >EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger protein. Length = 993 Score = 27.5 bits (58), Expect = 0.59 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 6/42 (14%) Frame = -3 Query: 263 GPGPSTGKRP------RSRRTWTGVVATRKRNLPNTTSPVID 156 G G S GK+P ++ R W GV+ KR P S ++D Sbjct: 400 GDGGSDGKKPPNNPLEKTNRLWGGVINDIKRRYPMYKSDIMD 441 >AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 25.4 bits (53), Expect = 2.4 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -3 Query: 257 GPSTGKRPRSRRTWTGVVATRKRNLPNTTSPVID 156 GP + PR WTGV+ T PN+ ++D Sbjct: 202 GPLRFRHPRPAEKWTGVLNT--TTPPNSCVQIVD 233 >AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 25.4 bits (53), Expect = 2.4 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -3 Query: 257 GPSTGKRPRSRRTWTGVVATRKRNLPNTTSPVID 156 GP + PR WTGV+ T PN+ ++D Sbjct: 202 GPLRFRHPRPAEKWTGVLNT--TTPPNSCVQIVD 233 >AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinesterase protein. Length = 623 Score = 25.4 bits (53), Expect = 2.4 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -3 Query: 257 GPSTGKRPRSRRTWTGVVATRKRNLPNTTSPVID 156 GP + PR WTGV+ T PN+ ++D Sbjct: 88 GPLRFRHPRPAEKWTGVLNT--TTPPNSCVQIVD 119 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 24.2 bits (50), Expect = 5.5 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -2 Query: 315 KQPDSKERPSRRDPPSLRAWP 253 K P S+ P RR P S WP Sbjct: 249 KIPPSRRNPRRRSPRSGGRWP 269 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 803,444 Number of Sequences: 2352 Number of extensions: 14398 Number of successful extensions: 20 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 97987887 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -