BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0617.Seq (907 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U21317-4|AAA62523.1| 719|Caenorhabditis elegans Hypothetical pr... 29 6.0 AF040655-7|AAB95044.2| 565|Caenorhabditis elegans Hypothetical ... 28 8.0 >U21317-4|AAA62523.1| 719|Caenorhabditis elegans Hypothetical protein B0495.2 protein. Length = 719 Score = 28.7 bits (61), Expect = 6.0 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = -2 Query: 315 KQPDSK-ERPSRRDPPSLRAWPLYGKTAPFKTNLDRSRRDEKAEPPEHH 172 K+ D K E+ R D +R K FK +RS RD+K HH Sbjct: 87 KERDKKREKDKRDDRRDVRGPDARQKDRDFKGRQERSGRDQKVHEHRHH 135 >AF040655-7|AAB95044.2| 565|Caenorhabditis elegans Hypothetical protein T24E12.9 protein. Length = 565 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = -3 Query: 260 PGPSTGKRPRSRRTWTGVVATRKRNLPNTTSPV 162 PGPST KR + V A RK+NLPN P+ Sbjct: 438 PGPSTLKRQSKT---SPVKAKRKKNLPNGPHPL 467 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,834,200 Number of Sequences: 27780 Number of extensions: 337555 Number of successful extensions: 822 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 735 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 822 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2307803960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -