BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0615.Seq (513 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 26 0.17 AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 24 0.69 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 23 1.2 DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory pro... 21 4.9 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 21 8.5 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 26.2 bits (55), Expect = 0.17 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = +1 Query: 319 LVNTIFFGVFLCSASIRFFFSKISQPIFENSFYCSIQKYFN 441 ++ T+ FLC R F I E ++ I+KY+N Sbjct: 291 MLGTVVLSFFLCLIPFRVFILWIILVPEEQVYHLEIEKYYN 331 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 24.2 bits (50), Expect = 0.69 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -3 Query: 424 YYSKNCSRI*AGKFWKKKNEYW 359 Y+ N +I A FWKKK YW Sbjct: 61 YFISNVYQILAYNFWKKK--YW 80 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 23.4 bits (48), Expect = 1.2 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -1 Query: 396 RLGNFGKKKTNTGRTEKYS 340 +L FGK+ +TGR KYS Sbjct: 4 KLQEFGKRGRSTGRGLKYS 22 >DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory protein 5 protein. Length = 144 Score = 21.4 bits (43), Expect = 4.9 Identities = 12/46 (26%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +3 Query: 141 QQKGQGKVSLRKAFQRQHRWANIHATLASDGQHQKSITM-TDYSWS 275 Q+K GK+ ++ W + A DG ++K + DY +S Sbjct: 92 QKKQAGKILTFVLLNYRNEWNQLVAKYDPDGIYRKQYEIDDDYDYS 137 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 20.6 bits (41), Expect = 8.5 Identities = 5/8 (62%), Positives = 8/8 (100%) Frame = +3 Query: 99 QRWDEHGR 122 ++WDEHG+ Sbjct: 325 KKWDEHGK 332 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,930 Number of Sequences: 336 Number of extensions: 1989 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12258909 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -