BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0607.Seq (830 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0460 - 18098187-18098248,18098331-18098399,18098468-180994... 29 6.0 >10_08_0460 - 18098187-18098248,18098331-18098399,18098468-18099434, 18100089-18100808,18100942-18101031,18101076-18101138, 18101223-18101366,18101471-18101527,18101606-18101680, 18101757-18101836,18101937-18102050,18102166-18102258, 18102470-18102553,18102812-18102859,18105207-18105337, 18105903-18106135 Length = 1009 Score = 28.7 bits (61), Expect = 6.0 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = -2 Query: 649 TTYTFL*NIHYKNKP*TTRSSMYNVESAMRVDVVVDDTMCRYGKIKKTI 503 T YT+ N+ KN+P + S V R VV+ T C+ + K + Sbjct: 523 TKYTYKCNLQGKNEPANKKKSNEQVTEQQRETVVLVKTNCKCTMVAKEV 571 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,833,078 Number of Sequences: 37544 Number of extensions: 327054 Number of successful extensions: 595 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 589 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 595 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2291695380 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -