BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0607.Seq (830 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ278310-1|CAB93496.1| 219|Anopheles gambiae serine protease-li... 24 4.9 DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide... 23 8.6 >AJ278310-1|CAB93496.1| 219|Anopheles gambiae serine protease-like protein protein. Length = 219 Score = 24.2 bits (50), Expect = 4.9 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +1 Query: 58 GEQNTINVIL*RTKALLSNNYSCFKKNSTKKLRHEITLH 174 G+Q T VIL + + + N C K T +L LH Sbjct: 99 GKQGTYQVILKKIELPIMPNEECQKALRTTRLGRRFKLH 137 >DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide F receptor protein. Length = 575 Score = 23.4 bits (48), Expect = 8.6 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = -2 Query: 340 LVFVWNGIVFVPLPLGALFQLH 275 +V +W+ + V +P G +LH Sbjct: 214 IVLIWSFAIMVTMPYGLYMKLH 235 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 769,681 Number of Sequences: 2352 Number of extensions: 15072 Number of successful extensions: 25 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 87651612 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -