BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0599.Seq (871 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8GEG0 Cluster: Putative uncharacterized protein; n=1; ... 115 2e-24 UniRef50_Q37953 Cluster: LacZ protein; n=1; Phage M13mp18|Rep: L... 115 2e-24 UniRef50_P00722 Cluster: Beta-galactosidase; n=35; root|Rep: Bet... 115 2e-24 UniRef50_Q47336 Cluster: LacZ-alpha peptide; n=2; cellular organ... 103 6e-21 UniRef50_UPI0000498F17 Cluster: beta-galactosidase; n=3; Eukaryo... 76 1e-12 UniRef50_Q669R9 Cluster: Beta-galactosidase; n=14; Yersinia|Rep:... 76 1e-12 UniRef50_A7MN76 Cluster: Putative uncharacterized protein; n=1; ... 66 1e-09 UniRef50_P06219 Cluster: Beta-galactosidase; n=11; Gammaproteoba... 58 3e-07 UniRef50_A0ZLG1 Cluster: Beta-D-galactosidase; n=1; Nodularia sp... 55 3e-06 UniRef50_P81650 Cluster: Beta-galactosidase; n=26; Gammaproteoba... 52 2e-05 UniRef50_A6FJQ2 Cluster: 50S ribosomal protein L5; n=8; Bacteria... 50 1e-04 UniRef50_Q15XN9 Cluster: Glycoside hydrolase family 2, TIM barre... 46 0.002 UniRef50_A6DI70 Cluster: Beta-D-galactosidase; n=1; Lentisphaera... 41 0.047 UniRef50_Q9JN59 Cluster: Beta-galactosidase; n=16; Vibrio choler... 40 0.062 UniRef50_A0M224 Cluster: Beta-galactosidase; n=1; Gramella forse... 40 0.062 UniRef50_A0UVE2 Cluster: Glycoside hydrolase family 2, TIM barre... 39 0.14 UniRef50_A7LU08 Cluster: Putative uncharacterized protein; n=1; ... 38 0.25 UniRef50_A7BPF2 Cluster: LacZ alpha peptide; n=1; Beggiatoa sp. ... 38 0.25 UniRef50_Q1II16 Cluster: Glycoside hydrolase family 2, TIM barre... 37 0.58 UniRef50_A5FCG4 Cluster: Beta-galactosidase precursor; n=1; Flav... 37 0.58 UniRef50_Q15NH4 Cluster: Glycoside hydrolase family 2, TIM barre... 36 1.3 UniRef50_Q48727 Cluster: Beta-galactosidase; n=3; Lactococcus la... 36 1.3 UniRef50_Q8A2G5 Cluster: Beta-galactosidase; n=8; Bacteroidales|... 36 1.8 UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3; ... 35 2.3 UniRef50_A7CVC4 Cluster: Beta-galactosidase; n=1; Opitutaceae ba... 35 3.1 UniRef50_A3XMD4 Cluster: Beta-galactosidase; n=1; Leeuwenhoekiel... 34 5.4 UniRef50_Q5DC94 Cluster: SJCHGC09076 protein; n=1; Schistosoma j... 34 5.4 UniRef50_Q2VT50 Cluster: Beta-galactosidase precursor; n=2; Flav... 33 7.1 UniRef50_A4AN51 Cluster: Beta-galactosidase; n=1; Flavobacterial... 33 7.1 >UniRef50_Q8GEG0 Cluster: Putative uncharacterized protein; n=1; Erwinia amylovora|Rep: Putative uncharacterized protein - Erwinia amylovora (Fire blight bacteria) Length = 123 Score = 115 bits (276), Expect = 2e-24 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = +1 Query: 322 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRXLNGEWQ 480 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR LNGEW+ Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRXLNGEWR 120 >UniRef50_Q37953 Cluster: LacZ protein; n=1; Phage M13mp18|Rep: LacZ protein - Phage M13mp18 Length = 102 Score = 115 bits (276), Expect = 2e-24 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = +1 Query: 322 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRXLNGEWQ 480 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR LNGEW+ Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 78 >UniRef50_P00722 Cluster: Beta-galactosidase; n=35; root|Rep: Beta-galactosidase - Escherichia coli (strain K12) Length = 1024 Score = 115 bits (276), Expect = 2e-24 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = +1 Query: 322 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRXLNGEWQ 480 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR LNGEW+ Sbjct: 8 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 >UniRef50_Q47336 Cluster: LacZ-alpha peptide; n=2; cellular organisms|Rep: LacZ-alpha peptide - Escherichia coli Length = 90 Score = 103 bits (247), Expect = 6e-21 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = +1 Query: 322 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRXL 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR L Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 69 >UniRef50_UPI0000498F17 Cluster: beta-galactosidase; n=3; Eukaryota|Rep: beta-galactosidase - Entamoeba histolytica HM-1:IMSS Length = 86 Score = 75.8 bits (178), Expect = 1e-12 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +2 Query: 320 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAK 424 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVI++ Sbjct: 5 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVISE 39 Score = 33.5 bits (73), Expect = 7.1 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = +1 Query: 418 SEEARTDRPSQQLRXLNGEWQI 483 SEEARTDRPSQQLR L +W++ Sbjct: 38 SEEARTDRPSQQLRSL--KWRM 57 >UniRef50_Q669R9 Cluster: Beta-galactosidase; n=14; Yersinia|Rep: Beta-galactosidase - Yersinia pseudotuberculosis Length = 1066 Score = 75.8 bits (178), Expect = 1e-12 Identities = 32/52 (61%), Positives = 38/52 (73%) Frame = +1 Query: 322 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRXLNGEW 477 L +L RRDWENP +TQ +RL AHPPF SWR+ E A+ DRPS Q + LNG W Sbjct: 15 LPQILSRRDWENPQITQYHRLEAHPPFHSWRDVESAQKDRPSPQQQTLNGLW 66 >UniRef50_A7MN76 Cluster: Putative uncharacterized protein; n=1; Enterobacter sakazakii ATCC BAA-894|Rep: Putative uncharacterized protein - Enterobacter sakazakii ATCC BAA-894 Length = 1043 Score = 66.1 bits (154), Expect = 1e-09 Identities = 25/53 (47%), Positives = 35/53 (66%) Frame = +1 Query: 322 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRXLNGEWQ 480 LA +L R DW+NP +T +NRL +H P WR+++ AR PS + L+GEWQ Sbjct: 18 LATILARNDWQNPAITSVNRLPSHTPLHGWRDADRARRGEPSDAVLSLDGEWQ 70 >UniRef50_P06219 Cluster: Beta-galactosidase; n=11; Gammaproteobacteria|Rep: Beta-galactosidase - Klebsiella pneumoniae Length = 1034 Score = 58.0 bits (134), Expect = 3e-07 Identities = 26/47 (55%), Positives = 31/47 (65%) Frame = +1 Query: 331 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRXLNG 471 VL R DW N +T LNRL AHP FASWR+ AR + PS + R L+G Sbjct: 17 VLAREDWHNQTITHLNRLPAHPVFASWRDELAARDNLPSSRRRQLDG 63 >UniRef50_A0ZLG1 Cluster: Beta-D-galactosidase; n=1; Nodularia spumigena CCY 9414|Rep: Beta-D-galactosidase - Nodularia spumigena CCY 9414 Length = 72 Score = 54.8 bits (126), Expect = 3e-06 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = +1 Query: 409 WRNSEEARTDRPSQQLRXLNGEWQIV 486 WRNSEEARTDRPSQQLR LNGEW+++ Sbjct: 47 WRNSEEARTDRPSQQLRSLNGEWRLM 72 >UniRef50_P81650 Cluster: Beta-galactosidase; n=26; Gammaproteobacteria|Rep: Beta-galactosidase - Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) Length = 1039 Score = 52.0 bits (119), Expect = 2e-05 Identities = 21/49 (42%), Positives = 33/49 (67%) Frame = +1 Query: 331 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRXLNGEW 477 ++ RRDWENP Q+N++ AH P ++ E+AR + SQ+ + LNG+W Sbjct: 7 IINRRDWENPITVQVNQVKAHSPLNGFKTIEDARENTQSQK-KSLNGQW 54 >UniRef50_A6FJQ2 Cluster: 50S ribosomal protein L5; n=8; Bacteria|Rep: 50S ribosomal protein L5 - Moritella sp. PE36 Length = 45 Score = 49.6 bits (113), Expect = 1e-04 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -2 Query: 486 YNLPFAIQXAQLLGRAIGAGLFAITPAGERG 394 + PFAIQ AQLLGRAIGAGLFAITP E G Sbjct: 8 HQAPFAIQAAQLLGRAIGAGLFAITPEFELG 38 >UniRef50_Q15XN9 Cluster: Glycoside hydrolase family 2, TIM barrel precursor; n=1; Pseudoalteromonas atlantica T6c|Rep: Glycoside hydrolase family 2, TIM barrel precursor - Pseudoalteromonas atlantica (strain T6c / BAA-1087) Length = 1079 Score = 45.6 bits (103), Expect = 0.002 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +1 Query: 340 RRDWENPGVTQLNRLAAHPPFASWRNSEEART-DRPSQQLRXLNGEWQ 480 + DWENP V Q+NRL A S+ E+A T DR ++ LNG+W+ Sbjct: 31 KNDWENPDVIQINRLPARATSYSFDTPEQALTRDRNQSTIQSLNGQWK 78 >UniRef50_A6DI70 Cluster: Beta-D-galactosidase; n=1; Lentisphaera araneosa HTCC2155|Rep: Beta-D-galactosidase - Lentisphaera araneosa HTCC2155 Length = 991 Score = 40.7 bits (91), Expect = 0.047 Identities = 19/49 (38%), Positives = 23/49 (46%) Frame = +1 Query: 349 WENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRXLNGEWQIVSVN 495 WENP LN LA PP S+ + E+A S + LNG W N Sbjct: 6 WENPQFVSLNTLAPRPPLYSFDSLEKALEQDQSAYIHSLNGSWNFKLFN 54 >UniRef50_Q9JN59 Cluster: Beta-galactosidase; n=16; Vibrio cholerae|Rep: Beta-galactosidase - Vibrio cholerae Length = 56 Score = 40.3 bits (90), Expect = 0.062 Identities = 17/50 (34%), Positives = 29/50 (58%) Frame = +1 Query: 331 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRXLNGEWQ 480 +L +DW+NP + + + H P S+R +EAR D + + LNG+W+ Sbjct: 7 ILLSQDWQNPHIVKWHCRTPHVPLHSYRTEQEARLDVGGNR-QSLNGQWR 55 >UniRef50_A0M224 Cluster: Beta-galactosidase; n=1; Gramella forsetii KT0803|Rep: Beta-galactosidase - Gramella forsetii (strain KT0803) Length = 1049 Score = 40.3 bits (90), Expect = 0.062 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = +1 Query: 346 DWENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRXLNGEWQ 480 DWENP VT +N+L A S+ N + A S +++ LNG WQ Sbjct: 26 DWENPAVTGINKLPARATMYSFSNKQAAINLNKENSDRVKSLNGTWQ 72 >UniRef50_A0UVE2 Cluster: Glycoside hydrolase family 2, TIM barrel; n=1; Clostridium cellulolyticum H10|Rep: Glycoside hydrolase family 2, TIM barrel - Clostridium cellulolyticum H10 Length = 1033 Score = 39.1 bits (87), Expect = 0.14 Identities = 16/48 (33%), Positives = 30/48 (62%), Gaps = 2/48 (4%) Frame = +1 Query: 343 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDR--PSQQLRXLNGEWQ 480 R+WEN +TQ+NR H P+ ++ + E+A + S+ ++ L+G W+ Sbjct: 3 REWENQYITQINRYPMHSPYGAYESVEQAMSCNRWTSKYVKSLSGIWK 50 >UniRef50_A7LU08 Cluster: Putative uncharacterized protein; n=1; Bacteroides ovatus ATCC 8483|Rep: Putative uncharacterized protein - Bacteroides ovatus ATCC 8483 Length = 1046 Score = 38.3 bits (85), Expect = 0.25 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +1 Query: 337 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP--SQQLRXLNGEWQIV 486 Q +WENP + N+ H F + +E+A D+P S LNG W+ + Sbjct: 26 QNNEWENPAKYEWNKERPHADFRLYEQAEDAVNDKPRKSSWQHSLNGVWKFI 77 >UniRef50_A7BPF2 Cluster: LacZ alpha peptide; n=1; Beggiatoa sp. SS|Rep: LacZ alpha peptide - Beggiatoa sp. SS Length = 73 Score = 38.3 bits (85), Expect = 0.25 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -1 Query: 781 GLXLGFHFSALRHLDPQKLE 722 GL LGF FSALRHLDP+KL+ Sbjct: 54 GLPLGFRFSALRHLDPKKLD 73 >UniRef50_Q1II16 Cluster: Glycoside hydrolase family 2, TIM barrel precursor; n=1; Acidobacteria bacterium Ellin345|Rep: Glycoside hydrolase family 2, TIM barrel precursor - Acidobacteria bacterium (strain Ellin345) Length = 1049 Score = 37.1 bits (82), Expect = 0.58 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = +1 Query: 337 QRRDWENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRXLNGEWQ 480 Q DWENP V +NR A F + + A R ++PS ++ LNG W+ Sbjct: 21 QTPDWENPRVFGINREAPRATFTPFPDEASALKRREQPSVFMQSLNGMWK 70 >UniRef50_A5FCG4 Cluster: Beta-galactosidase precursor; n=1; Flavobacterium johnsoniae UW101|Rep: Beta-galactosidase precursor - Flavobacterium johnsoniae UW101 Length = 1108 Score = 37.1 bits (82), Expect = 0.58 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 2/52 (3%) Frame = +1 Query: 349 WENPGVTQLNRLAAHPPFASWRNSEEA-RTDRPSQQLRXLNGEWQI-VSVNI 498 WE+P +T +NR + S+ + E+A + DR +++ LNG+W +VN+ Sbjct: 57 WEDPTITSINRQPSRATAYSYSSVEDALKGDRTKSRIQMLNGDWDFKYAVNL 108 >UniRef50_Q15NH4 Cluster: Glycoside hydrolase family 2, TIM barrel; n=1; Pseudoalteromonas atlantica T6c|Rep: Glycoside hydrolase family 2, TIM barrel - Pseudoalteromonas atlantica (strain T6c / BAA-1087) Length = 1045 Score = 35.9 bits (79), Expect = 1.3 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +1 Query: 346 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRP--SQQLRXLNGEW 477 DW+NP V +N+ A F + + + D P SQ LNGEW Sbjct: 11 DWQNPEVFAINKEPARSSFYGFSDDPQGYVDSPFMSQDYLSLNGEW 56 >UniRef50_Q48727 Cluster: Beta-galactosidase; n=3; Lactococcus lactis|Rep: Beta-galactosidase - Lactococcus lactis subsp. lactis (Streptococcus lactis) Length = 998 Score = 35.9 bits (79), Expect = 1.3 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +1 Query: 331 VLQRRDWENPGVTQLNRLAAHPP 399 VL+R+DWENP V+ NRL H P Sbjct: 9 VLERKDWENPVVSNWNRLPMHTP 31 >UniRef50_Q8A2G5 Cluster: Beta-galactosidase; n=8; Bacteroidales|Rep: Beta-galactosidase - Bacteroides thetaiotaomicron Length = 1036 Score = 35.5 bits (78), Expect = 1.8 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 2/47 (4%) Frame = +1 Query: 346 DWENPGVTQLNRLAAHPPFASWRNSEEAR--TDRPSQQLRXLNGEWQ 480 +W++P V +NR A H + ++ +++EA+ + SQ LNG W+ Sbjct: 26 EWKDPEVNSVNRSAMHTNYFAYASADEAKAGSKEDSQNFMTLNGLWK 72 >UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein - Plasmodium berghei Length = 275 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 272 GGARYPIRPIVSRIT 316 GGARYPIRPIVSRIT Sbjct: 261 GGARYPIRPIVSRIT 275 >UniRef50_A7CVC4 Cluster: Beta-galactosidase; n=1; Opitutaceae bacterium TAV2|Rep: Beta-galactosidase - Opitutaceae bacterium TAV2 Length = 1130 Score = 34.7 bits (76), Expect = 3.1 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +1 Query: 349 WENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR--XLNGEWQ 480 WE P +T LN+L F + + +EAR + + R LNG WQ Sbjct: 10 WEAPELTSLNKLPPRATFHGFGSVKEARAGKSEKSTRHHSLNGTWQ 55 >UniRef50_A3XMD4 Cluster: Beta-galactosidase; n=1; Leeuwenhoekiella blandensis MED217|Rep: Beta-galactosidase - Leeuwenhoekiella blandensis MED217 Length = 1033 Score = 33.9 bits (74), Expect = 5.4 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 2/50 (4%) Frame = +1 Query: 337 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ--LRXLNGEWQ 480 Q+ +WENP + N+ F + +++A+T SQ + LNG W+ Sbjct: 20 QQNEWENPKIIDRNKEEGRASFVLFEKTQKAKTRDASQSQFYKSLNGVWK 69 >UniRef50_Q5DC94 Cluster: SJCHGC09076 protein; n=1; Schistosoma japonicum|Rep: SJCHGC09076 protein - Schistosoma japonicum (Blood fluke) Length = 109 Score = 33.9 bits (74), Expect = 5.4 Identities = 19/52 (36%), Positives = 28/52 (53%) Frame = +1 Query: 325 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRXLNGEWQ 480 A L+RR+ +NPG QLN L A P F +++A +R S+ G+ Q Sbjct: 57 AAFLKRREGKNPGCPQLNPLEALPLFPGGEKTKKAPPNRLSKNWPPPEGQRQ 108 >UniRef50_Q2VT50 Cluster: Beta-galactosidase precursor; n=2; Flavobacterium|Rep: Beta-galactosidase precursor - Flavobacterium sp. 4214 Length = 1046 Score = 33.5 bits (73), Expect = 7.1 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +1 Query: 340 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTD--RPSQQLRXLNGEWQ 480 R DWENP V Q+NR A F + + A D S L+G+W+ Sbjct: 28 RNDWENPEVFQINREPARAAFLPFADEASAIADDYTRSPWYMSLDGKWK 76 >UniRef50_A4AN51 Cluster: Beta-galactosidase; n=1; Flavobacteriales bacterium HTCC2170|Rep: Beta-galactosidase - Flavobacteriales bacterium HTCC2170 Length = 1126 Score = 33.5 bits (73), Expect = 7.1 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = +1 Query: 346 DWENPGVTQLNRLAAHPPFASWRNSEEART--DRPSQQLRXLNGEW 477 DWENP + +N+L H F +++ E A + S + + LNG W Sbjct: 27 DWENPEIFGINKLEPHAFFIPFQSQESALSFDATRSDRYQLLNGYW 72 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 779,156,299 Number of Sequences: 1657284 Number of extensions: 15212958 Number of successful extensions: 30868 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 30102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30864 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 77472727479 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -